SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMG10308_internal:A_BomoMG_comp38125_c0_seq1
Scaffold_idBomo_Chr22
NCBI non-redundant
(nr)
PREDICTED:_cAMP-specific_3',5'-cyclic_phosphodiesterase_isoform_X5_[Bombyx_mori]
Ontology
GO:0000003 P reproduction
GO:0001661 P conditioned taste aversion
GO:0004114 F 3',5'-cyclic-nucleotide phosphodiesterase activity
GO:0005622 C intracellular anatomical structure
GO:0006198 P cAMP catabolic process
GO:0007165 P signal transduction
GO:0007268 P chemical synaptic transmission
GO:0007611 P learning or memory
GO:0007612 P learning
GO:0007613 P memory
GO:0007614 P short-term memory
GO:0007617 P mating behavior
GO:0007619 P courtship behavior
GO:0007623 P circadian rhythm
GO:0008081 F phosphoric diester hydrolase activity
GO:0008306 P associative learning
GO:0008355 P olfactory learning
GO:0009187 P cyclic nucleotide metabolic process
GO:0010738 P regulation of protein kinase A signaling
GO:0016787 F hydrolase activity
GO:0019933 P cAMP-mediated signaling
GO:0040040 P thermosensory behavior
GO:0045475 P locomotor rhythm
GO:0046331 P lateral inhibition
GO:0046872 F metal ion binding
GO:0046958 P nonassociative learning
GO:0048149 P behavioral response to ethanol
GO:0048477 P oogenesis
GO:0048675 P axon extension
RNA-seq EntryA_BomoMG_comp38125_c0_seq1
Sequence
(Amino Acid)
FNIKRTLSYADNLLDVIRRLTASAMSGRQLRVPEVRVCGAPPQEEDDPPTALPPFALTLA
SIPRRRHSWICSFDVENGGGAGVAGGARSPLEGGSPSAALVLQAMPQRRESF
(36 a.a.)

- SilkBase 1999-2023 -