SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMG10302_complete:A_BomoMG_comp38124_c0_seq1
Scaffold_idBomo_Chr13
NCBI non-redundant
(nr)		hypothetical_protein_KGM_03318_[Danaus_plexippus]
Ontology
GO:0000502 C proteasome complex
GO:0001541 P ovarian follicle development
GO:0003713 F transcription coactivator activity
GO:0004842 F ubiquitin-protein transferase activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0006511 P ubiquitin-dependent protein catabolic process
GO:0014068 P positive regulation of phosphatidylinositol 3-kinase signaling
GO:0016567 P protein ubiquitination
GO:0016874 F ligase activity
GO:0030521 P androgen receptor signaling pathway
GO:0031398 P positive regulation of protein ubiquitination
GO:0035037 P sperm entry
GO:0042752 P regulation of circadian rhythm
GO:0042787 P ubiquitin-dependent protein catabolic process
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046872 F metal ion binding
GO:0048511 P rhythmic process
GO:0051865 P protein autoubiquitination
GO:0060736 P prostate gland growth
GO:0061630 F ubiquitin protein ligase activity
GO:0070936 P protein K48-linked ubiquitination
GO:2000058 P regulation of ubiquitin-dependent protein catabolic process
RNA-seq EntryA_BomoMG_comp38124_c0_seq1
Sequence
(Amino Acid)
MNPKSESVEASRGSEASSSSINSTPDIVEDQLTSGNIMKRAAAKQLIEKYFYQLLDGCGN
VNCDNRYCASSGAARNLSPNEAAAEAIKLFYKEARLCSSVTPNKVSRTDSNSYEPSPSST
LGPNHKNTSENKENQNITTPEPSTASRGEPHTSHTAQQGLILIHMSQAQVRHLGRITKTH
QRIKRIKISQHRSQALRHEGNLILVTPHSNRNKRKENAITMEHH
*(74 a.a.)

- SilkBase 1999-2023 -