SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMG10280_3prime_partial:A_BomoMG_comp38110_c1_seq1
Scaffold_idBomo_Chr13
NCBI non-redundant
(nr)		PREDICTED:_uncharacterized_protein_LOC101739643_isoform_X2_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0000228 C nuclear chromosome
GO:0000781 C chromosome, telomeric region
GO:0000784 C chromosome, telomeric region
GO:0000792 C heterochromatin
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0004386 F helicase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005694 C chromosome
GO:0005721 C pericentric heterochromatin
GO:0006281 P DNA repair
GO:0006334 P nucleosome assembly
GO:0006336 P DNA replication-independent chromatin assembly
GO:0006338 P chromatin remodeling
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006974 P cellular response to DNA damage stimulus
GO:0007283 P spermatogenesis
GO:0010571 P positive regulation of nuclear cell cycle DNA replication
GO:0015616 F DNA translocase activity
GO:0016568 P chromatin organization
GO:0016605 C PML body
GO:0016787 F hydrolase activity
GO:0030330 P DNA damage response, signal transduction by p53 class mediator
GO:0030900 P forebrain development
GO:0031297 P replication fork processing
GO:0031933 C obsolete telomeric heterochromatin
GO:0032206 P positive regulation of telomere maintenance
GO:0035064 F methylated histone binding
GO:0035128 P post-embryonic forelimb morphogenesis
GO:0035264 P multicellular organism growth
GO:0042393 F histone binding
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046872 F metal ion binding
GO:0060009 P Sertoli cell development
GO:0070087 F chromo shadow domain binding
GO:0070198 P protein localization to chromosome, telomeric region
GO:0070603 C SWI/SNF superfamily-type complex
GO:0072520 P seminiferous tubule development
GO:0072711 P cellular response to hydroxyurea
GO:1901581 P negative regulation of telomeric RNA transcription from RNA pol II promoter
GO:1901582 P positive regulation of telomeric RNA transcription from RNA pol II promoter
GO:1904908 P negative regulation of maintenance of mitotic sister chromatid cohesion, telomeric
GO:1990707 C chromosome, subtelomeric region
RNA-seq EntryA_BomoMG_comp38110_c1_seq1
Sequence
(Amino Acid)
MRIPNDLGTTMSEIIKSEGACPAPEKPASSDENVQFPPLPEPTDEDFQDDLNEEEKEYIK
TKFADLNTITSQRLHCTACDRHLGSSSRNLSRVKIHPLLRTLVCQTCHIFYNSGEFEKGD
DGSELYCRWCGQGGQVFCCSDCPHVFCAKCIKRNFGQSKILEIKCVDDWKCFKCNPECLK
HLRAVCWALFQYCKARIEIATYTVDTQIRELLTKQCAADESLCCKNKSKRSEKLDPVKKK
EENGPKKQTPVPIISKIP
(85 a.a.)

- SilkBase 1999-2023 -