SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMG10274_internal:A_BomoMG_comp38109_c0_seq1
Scaffold_idBomo_Chr1
NCBI non-redundant
(nr)		PREDICTED:_E3_ubiquitin-protein_ligase_MYCBP2-like_[Bombyx_mori]
Ontology
GO:0004842 F ubiquitin-protein transferase activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005886 C plasma membrane
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006914 P autophagy
GO:0007616 P long-term memory
GO:0007628 P adult walking behavior
GO:0008270 F zinc ion binding
GO:0008582 P regulation of synaptic assembly at neuromuscular junction
GO:0016023 C cytoplasmic vesicle
GO:0016567 P protein ubiquitination
GO:0016874 F ligase activity
GO:0030509 P BMP signaling pathway
GO:0030514 P negative regulation of BMP signaling pathway
GO:0040011 P locomotion
GO:0045886 P negative regulation of synaptic assembly at neuromuscular junction
GO:0046872 F metal ion binding
GO:0048678 P response to axon injury
GO:0050808 P synapse organization
GO:2000331 P regulation of terminal button organization
RNA-seq EntryA_BomoMG_comp38109_c0_seq1
Sequence
(Amino Acid)
LSQELAIPCAPKCSITRMHAVLHLLACLDSLNYAHDNKLQFDVRLSQVECKRDNASAPEA
SMKEDFLTVNRFESHGGGWGYSGHSVEAIRFMCDTDILLGGYGLFGGRG
(35 a.a.)

- SilkBase 1999-2023 -