SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMG10270_5prime_partial:A_BomoMG_comp38105_c0_seq1
Scaffold_idBomo_Chr13
NCBI non-redundant
(nr)		protein_sprouty_[Bombyx_mori]
Ontology
GO:0001745 P compound eye morphogenesis
GO:0001763 P morphogenesis of a branching structure
GO:0005622 C intracellular anatomical structure
GO:0005886 C plasma membrane
GO:0007169 P transmembrane receptor protein tyrosine kinase signaling pathway
GO:0007173 P epidermal growth factor receptor signaling pathway
GO:0007275 P multicellular organism development
GO:0007424 P open tracheal system development
GO:0007426 P tracheal outgrowth, open tracheal system
GO:0007429 P secondary branching, open tracheal system
GO:0007430 P terminal branching, open tracheal system
GO:0008293 P torso signaling pathway
GO:0008595 P anterior/posterior axis specification, embryo
GO:0009966 P regulation of signal transduction
GO:0009968 P negative regulation of signal transduction
GO:0016020 C membrane
GO:0016318 P ommatidial rotation
GO:0021782 P glial cell development
GO:0030707 P ovarian follicle cell development
GO:0035155 P negative regulation of terminal cell fate specification, open tracheal system
GO:0040037 P negative regulation of fibroblast growth factor receptor signaling pathway
GO:0042059 P negative regulation of epidermal growth factor receptor signaling pathway
GO:0045314 P regulation of compound eye photoreceptor development
GO:0046580 P negative regulation of Ras protein signal transduction
GO:0048747 P muscle cell development
GO:0060446 P branching involved in open tracheal system development
RNA-seq EntryA_BomoMG_comp38105_c0_seq1
Sequence
(Amino Acid)
PRPPKPAARVHRPSGARQPTVSLLRPRPEAERERNAYVEAPRRTHVSPAAAHAGAHQPLK
PVTTQPAAAADKRRAGALQADSIVCETCGRCRCEQCARPRPLPSRWLCGSCLCSAEACVD
YASCMCCVKALFYHCGSGEEEAGEPCACGPRLACVGALAVPLPCLWLYWPLRGCAAAGAA
LYARCRRSGCRCPDPQPRLSSII
*(67 a.a.)

- SilkBase 1999-2023 -