SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMG10236_3prime_partial:A_BomoMG_comp38082_c0_seq4
Scaffold_idBomo_Chr5
NCBI non-redundant
(nr)		PREDICTED:_immunoglobulin-binding_protein_1b-like_[Plutella_xylostella]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005874 C microtubule
GO:0007165 P signal transduction
GO:0008601 F protein phosphatase regulator activity
GO:0009966 P regulation of signal transduction
GO:0019904 F protein domain specific binding
GO:0031434 F mitogen-activated protein kinase kinase binding
GO:0032403 F protein-containing complex binding
GO:0032873 P negative regulation of stress-activated MAPK cascade
GO:0034047 P regulation of phosphoprotein phosphatase activity
GO:0034612 P response to tumor necrosis factor
GO:0035306 P positive regulation of dephosphorylation
GO:0035308 P negative regulation of protein dephosphorylation
GO:0042113 P B cell activation
GO:0043154 P negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0051721 F protein phosphatase 2A binding
GO:0060632 P regulation of microtubule-based movement
GO:0070555 P response to interleukin-1
GO:2001234 P negative regulation of apoptotic signaling pathway
RNA-seq EntryA_BomoMG_comp38082_c0_seq4
Sequence
(Amino Acid)
MAEVDTEQDILEDSLSNIFDQGMKLYTTVETVKEPMNSDSVQVTIKTAISKFEKATKLVS
LSGMFSKNEKLEELPTETLKYMLLPALLGTLTLKICRPSRKDIIEVAEIYFKDFLQRCKD
YGVTDVEIPQLSDSNSSSSRPQSQQDIIAAMVQSRETKIKRYKEAKELKEKLGTLSKAMS
SPIVDDEVKREYFLTMLHSYVNEVLDELSSIEREKPILEMISCSGEVPSTKEKPKARPLK
PVIITRDAVQKAVFGIGYPSIPTMTVE
(88 a.a.)

- SilkBase 1999-2023 -