SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMG10052_internal:A_BomoMG_comp37970_c0_seq1
Scaffold_idBomo_Chr21
NCBI non-redundant
(nr)		PREDICTED:_TFIIH_basal_transcription_factor_complex_helicase_XPD_subunit_isoform_X1_[Papilio_xuthus]
Ontology
GO:0000166 F nucleotide binding
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0004003 F DNA helicase activity
GO:0004386 F helicase activity
GO:0004672 F protein kinase activity
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005675 C transcription factor TFIIH holo complex
GO:0005737 C cytoplasm
GO:0005819 C spindle
GO:0005856 C cytoskeleton
GO:0006139 P nucleobase-containing compound metabolic process
GO:0006281 P DNA repair
GO:0006289 P nucleotide-excision repair
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006366 P transcription by RNA polymerase II
GO:0006468 P protein phosphorylation
GO:0006974 P cellular response to DNA damage stimulus
GO:0006979 P response to oxidative stress
GO:0007059 P chromosome segregation
GO:0008022 F protein C-terminus binding
GO:0008026 F helicase activity
GO:0008094 F ATP-dependent activity, acting on DNA
GO:0008353 F RNA polymerase II CTD heptapeptide repeat kinase activity
GO:0016787 F hydrolase activity
GO:0016818 F hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
GO:0019907 C cyclin-dependent protein kinase activating kinase holoenzyme complex
GO:0032508 P DNA duplex unwinding
GO:0033683 P nucleotide-excision repair, DNA incision
GO:0035315 P hair cell differentiation
GO:0043139 F 5'-3' DNA helicase activity
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046872 F metal ion binding
GO:0051536 F iron-sulfur cluster binding
GO:0051539 F 4 iron, 4 sulfur cluster binding
GO:0071817 C MMXD complex
GO:1901990 P regulation of mitotic cell cycle phase transition
RNA-seq EntryA_BomoMG_comp37970_c0_seq1
Sequence
(Amino Acid)
YIYPEQYAYMLELKRALDAKGHGLLEMPSGTGKTISLLSLIVAYMIQNPHHVRKLIYCSR
TVPEIEKVLEELKNLFNYYEKSQGEKPNLTGVVLSSRKNLCIHPDVSREREGKLVDGKCH
ALTASYIRDRHERDSSVPICQFYEGFNREGKESMLPYGVYTMDDMKQYGADRNWCPYFLA
RFAIIHAEIVVYSYHYLLDPKIAEVVSKELNREAVVVFDEAHNIDNVCIDSLSVKITRRT
IDKSSQALQQLEKTVAEIRDEDAARLTMEYEQLVAGLKDAAIQRETDTILGNPILPDEVL
NEVVPGNIRNAEHFLSFLKRFIEYVKTRLRIQHVVQESPAGFLKDVSSRVCIERKPLRFC
ASRLASLMRTLQIPDPSHLSSLVLITHLATLVSTYTKGFTIIIEPFDDKTPNVSNPILHF
SCMDSSIAMRPVFARFQTVIITSGTLSPLDMYPKILDFNPVIMSSFTMTLARPCILPMIV
SKGSDQVAISSKYETREDVAVIRNYGQLLVEMSAC
(170 a.a.)

- SilkBase 1999-2023 -