SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoMG10035_internal:A_BomoMG_comp37960_c0_seq1
Scaffold_idBomo_Chr26
NCBI non-redundant
(nr)
PREDICTED:_wolframin_isoform_X4_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000502 C proteasome complex
GO:0001822 P kidney development
GO:0003091 P renal water homeostasis
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0007601 P visual perception
GO:0007605 P sensory perception of sound
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0030176 C integral component of endoplasmic reticulum membrane
GO:0030425 C dendrite
GO:0030433 P ubiquitin-dependent ERAD pathway
GO:0030968 P endoplasmic reticulum unfolded protein response
GO:0031398 P positive regulation of protein ubiquitination
GO:0031625 F ubiquitin protein ligase binding
GO:0032469 P endoplasmic reticulum calcium ion homeostasis
GO:0033613 F DNA-binding transcription factor binding
GO:0034976 P response to endoplasmic reticulum stress
GO:0042593 P glucose homeostasis
GO:0043069 P negative regulation of programmed cell death
GO:0043433 P negative regulation of DNA-binding transcription factor activity
GO:0043524 P negative regulation of neuron apoptotic process
GO:0045762 P positive regulation of adenylate cyclase activity
GO:0045927 P positive regulation of growth
GO:0050821 P protein stabilization
GO:0050877 P nervous system process
GO:0051117 F ATPase binding
GO:0051247 P positive regulation of protein metabolic process
GO:0051726 P regulation of cell cycle
GO:0051928 P positive regulation of calcium ion transport
GO:0055074 P calcium ion homeostasis
GO:1902236 P negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway
GO:1903892 P negative regulation of ATF6-mediated unfolded protein response
GO:2000675 P negative regulation of type B pancreatic cell apoptotic process
RNA-seq EntryA_BomoMG_comp37960_c0_seq1
Sequence
(Amino Acid)
ECVPRWVSLLNVKNKWRDFAYWLPGFLQEYFKCYYGEEYSNVCRGSDGVQSVAECEFVSS
VARQSGKSCHLDNLNEYTYEVKLMMEASGGILKRHAEIVIHFGHYFTNFTRLLRSDDKIR
FKGTLSNENRPYNIGAKDLTIRGYEINCLECKEARGSVTLKTSSASKFSELFKTIVNDCV
VS
(59 a.a.)

- SilkBase 1999-2023 -