SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoMG10000_complete:A_BomoMG_comp37946_c0_seq4
Scaffold_idBomo_Chr13
NCBI non-redundant
(nr)		putative_sterol_regulatory_element-binding_protein_1_[Operophtera_brumata]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000139 C Golgi membrane
GO:0000247 F C-8 sterol isomerase activity
GO:0000978 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001078 F DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0005794 C Golgi apparatus
GO:0005829 C cytosol
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006629 P lipid metabolic process
GO:0008022 F protein C-terminus binding
GO:0008202 P steroid metabolic process
GO:0008203 P cholesterol metabolic process
GO:0009267 P cellular response to starvation
GO:0010886 P positive regulation of cholesterol storage
GO:0012507 C ER to Golgi transport vesicle membrane
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0031410 C cytoplasmic vesicle
GO:0032937 C SREBP-SCAP-Insig complex
GO:0044212 F transcription cis-regulatory region binding
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046983 F protein dimerization activity
GO:0055098 P cellular response to low-density lipoprotein particle stimulus
GO:0070888 F E-box binding
GO:0071499 P cellular response to laminar fluid shear stress
GO:0072368 P obsolete regulation of lipid transport by negative regulation of transcription from RNA polymerase II promoter
GO:0090370 P negative regulation of cholesterol efflux
GO:1903146 P regulation of autophagy of mitochondrion
GO:1903955 P positive regulation of protein targeting to mitochondrion
GO:2000188 P cholesterol homeostasis
RNA-seq EntryA_BomoMG_comp37946_c0_seq4
Sequence
(Amino Acid)
MMAGAAPRRTQQLLDGSLRPRFNRASIICGKERALEGGGGDGERAVALYMACKHLPAAVL
AAPGERAGMLAQAAATLQKIGHRSRLPHCYNLMKSFGTLPSAP
*(33 a.a.)

- SilkBase 1999-2023 -