SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoIG82165_internal:A_BomoIG_DN20304_c0_g1_i1
Scaffold_idBomo_Chr4
NCBI non-redundant
(nr)
retinol-binding_protein_pinta_[Bombyx_mori]
Ontology
GO:0001890 P placenta development
GO:0001892 P embryonic placenta development
GO:0005215 F transporter activity
GO:0005515 F protein binding
GO:0005546 F phosphatidylinositol-4,5-bisphosphate binding
GO:0005622 C intracellular anatomical structure
GO:0005737 C cytoplasm
GO:0005770 C late endosome
GO:0005829 C cytosol
GO:0006629 P lipid metabolic process
GO:0006810 P transport
GO:0007584 P response to nutrient
GO:0008289 F lipid binding
GO:0008431 F vitamin E binding
GO:0009268 P response to pH
GO:0009636 P response to toxic substance
GO:0019842 F vitamin binding
GO:0032502 P developmental process
GO:0042360 P vitamin E metabolic process
GO:0043325 F phosphatidylinositol-3,4-bisphosphate binding
GO:0046909 P obsolete intermembrane transport
GO:0051180 P vitamin transport
GO:0051452 P intracellular pH reduction
GO:0060548 P negative regulation of cell death
GO:0090212 P negative regulation of establishment of blood-brain barrier
RNA-seq EntryA_BomoIG_DN20304_c0_g1_i1
Sequence
(Amino Acid)
GEVNKVHGSLSDICKIGLMIAEILLLEDDNFTICGEDLVTDLKDMGFGLLRQWTPAFARK
LFMCFENALTIRMARIDLLNAPIGMKTAVAIFKLFLKEKLKKRIYIYNE
(35 a.a.)

- SilkBase 1999-2023 -