SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoIG52993_5prime_partial:A_BomoIG_DN21440_c0_g1_i1
Scaffold_idBomo_Chr19
NCBI non-redundant
(nr)		atrial_natriuretic_peptide_receptor_1_like_protein_[Danaus_plexippus_plexippus]
Ontology
GO:0000166 F nucleotide binding
GO:0004016 F adenylate cyclase activity
GO:0004383 F guanylate cyclase activity
GO:0004672 F protein kinase activity
GO:0005524 F ATP binding
GO:0005525 F GTP binding
GO:0005886 C plasma membrane
GO:0006182 P cGMP biosynthetic process
GO:0006468 P protein phosphorylation
GO:0006935 P chemotaxis
GO:0007165 P signal transduction
GO:0007606 P sensory perception of chemical stimulus
GO:0008074 C guanylate cyclase complex, soluble
GO:0009190 P cyclic nucleotide biosynthetic process
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016829 F lyase activity
GO:0016849 F phosphorus-oxygen lyase activity
GO:0030424 C axon
GO:0030425 C dendrite
GO:0035556 P intracellular signal transduction
GO:0042048 P olfactory behavior
GO:0042995 C cell projection
GO:0043005 C neuron projection
GO:0043204 C perikaryon
GO:0044297 C cell body
GO:0046872 F metal ion binding
GO:0050893 P sensory processing
RNA-seq EntryA_BomoIG_DN21440_c0_g1_i1
Sequence
(Amino Acid)
GETGWAAGDSRDAAARVAYEALLRVSLKLPTGDRFDDFADAVRARARLDYNYTFSDGEEV
NFFIGAFYDGVFLLGMALNETLTEGGDIRDGRNITRRMWGRDFYGITGHVRIDKVGDRDA
DYAILDLDPVTGKFEVVAFYHGLNSSYKPVPGKAIHWPGGRRGPPPDTPRCGFLGTDPTC
QGGN
*(60 a.a.)

- SilkBase 1999-2023 -