SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoIG52981_internal:A_BomoIG_DN20734_c0_g1_i1
Scaffold_idBomo_Chr17
NCBI non-redundant
(nr)
LOW_QUALITY_PROTEIN:_protein_abnormal_spindle_[Bombyx_mori]
Ontology
GO:0000132 P establishment of mitotic spindle orientation
GO:0000226 P microtubule cytoskeleton organization
GO:0000922 C spindle pole
GO:0005516 F calmodulin binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005813 C centrosome
GO:0005815 C microtubule organizing center
GO:0005819 C spindle
GO:0005856 C cytoskeleton
GO:0005874 C microtubule
GO:0005875 C microtubule associated complex
GO:0007017 P microtubule-based process
GO:0007049 P cell cycle
GO:0007051 P spindle organization
GO:0007052 P mitotic spindle organization
GO:0007067 P mitotic cell cycle
GO:0007097 P nuclear migration
GO:0007275 P multicellular organism development
GO:0007282 P cystoblast division
GO:0008017 F microtubule binding
GO:0030037 P actin filament reorganization involved in cell cycle
GO:0030154 P cell differentiation
GO:0030706 P germarium-derived oocyte differentiation
GO:0030723 P ovarian fusome organization
GO:0030954 P astral microtubule nucleation
GO:0032027 F myosin light chain binding
GO:0048132 P female germ-line stem cell asymmetric division
GO:0048477 P oogenesis
GO:0048854 P brain morphogenesis
GO:0051295 P establishment of meiotic spindle localization
GO:0051297 P centrosome cycle
GO:0051301 P cell division
GO:0051383 P kinetochore organization
GO:0051642 P centrosome localization
RNA-seq EntryA_BomoIG_DN20734_c0_g1_i1
Sequence
(Amino Acid)
LKSAAAVLVNLTRYRVTGPKIYARDRISPILKFMWRFSNSETQLFCILSSYLWLFAKYQD
VKKDLTEYFHLPENHKMLKTIKGNIDRMKRMATNTMKNKYHTPQPTRFVSH
(36 a.a.)

- SilkBase 1999-2023 -