SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoIG48920_internal:A_BomoIG_DN22418_c0_g2_i1
Scaffold_idBomo_Chr18
NCBI non-redundant
(nr)		delta-like_protein_1_[Bombyx_mori]
Ontology
GO:0001525 P angiogenesis
GO:0005509 F calcium ion binding
GO:0005515 F protein binding
GO:0005886 C plasma membrane
GO:0005938 C cell cortex
GO:0007154 P cell communication
GO:0007219 P Notch signaling pathway
GO:0007275 P multicellular organism development
GO:0007399 P nervous system development
GO:0008593 P regulation of Notch signaling pathway
GO:0009880 P embryonic pattern specification
GO:0014032 P neural crest cell development
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0021514 P ventral spinal cord interneuron differentiation
GO:0021536 P diencephalon development
GO:0022008 P neurogenesis
GO:0030154 P cell differentiation
GO:0030901 P midbrain development
GO:0033504 P floor plate development
GO:0055016 P hypochord development
GO:0060034 P notochord cell differentiation
GO:0060113 P inner ear receptor cell differentiation
RNA-seq EntryA_BomoIG_DN22418_c0_g2_i1
Sequence
(Amino Acid)
LPTALDTSPFLIFKFNYTWIKMRHAILLLICAAPAVLPKRTVKIPLWKRQACEPPAALSE
HSHYICNDKGEPKCMPGWQGDLCDVPICRKGCDPIRGFCKKPGECTCKFGYY
(36 a.a.)

- SilkBase 1999-2023 -