SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoIG48628_internal:A_BomoIG_DN1688_c0_g1_i2
Scaffold_idBomo_Chr4
NCBI non-redundant
(nr)		villin-like_protein_quail_[Bombyx_mori]
Ontology
GO:0001726 C ruffle
GO:0001951 P intestinal D-glucose absorption
GO:0003779 F actin binding
GO:0005509 F calcium ion binding
GO:0005515 F protein binding
GO:0005546 F phosphatidylinositol-4,5-bisphosphate binding
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005856 C cytoskeleton
GO:0005886 C plasma membrane
GO:0005902 C microvillus
GO:0005903 C brush border
GO:0006915 P apoptotic process
GO:0007010 P cytoskeleton organization
GO:0007173 P epidermal growth factor receptor signaling pathway
GO:0008360 P regulation of cell shape
GO:0009617 P response to bacterium
GO:0010634 P positive regulation of epithelial cell migration
GO:0030027 C lamellipodium
GO:0030033 P microvillus assembly
GO:0030041 P actin filament polymerization
GO:0030042 P actin filament depolymerization
GO:0030175 C filopodium
GO:0030335 P positive regulation of cell migration
GO:0030836 P positive regulation of actin filament depolymerization
GO:0030855 P epithelial cell differentiation
GO:0032233 P positive regulation of actin filament bundle assembly
GO:0032432 C actin filament bundle
GO:0032433 C filopodium tip
GO:0032532 P regulation of microvillus length
GO:0035727 F lysophosphatidic acid binding
GO:0035729 P cellular response to hepatocyte growth factor stimulus
GO:0040018 P positive regulation of multicellular organism growth
GO:0042802 F identical protein binding
GO:0042803 F protein homodimerization activity
GO:0042995 C cell projection
GO:0043027 F cysteine-type endopeptidase inhibitor activity involved in apoptotic process
GO:0043154 P negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0045010 P actin nucleation
GO:0046872 F metal ion binding
GO:0051014 P actin filament severing
GO:0051015 F actin filament binding
GO:0051016 P barbed-end actin filament capping
GO:0051125 P regulation of actin nucleation
GO:0051693 P actin filament capping
GO:0060327 P cytoplasmic actin-based contraction involved in cell motility
GO:0061041 P regulation of wound healing
GO:0070062 C extracellular exosome
GO:0071364 P cellular response to epidermal growth factor stimulus
GO:0090004 P positive regulation of protein localization to plasma membrane
GO:1902896 P terminal web assembly
GO:2000392 P regulation of lamellipodium morphogenesis
GO:2000394 P positive regulation of lamellipodium morphogenesis
RNA-seq EntryA_BomoIG_DN1688_c0_g1_i2
Sequence
(Amino Acid)
LYRVRGRRPLLVQLEPVSWSQLAADGVFVLDTSSLLVLWLGRAANLVEKIFGAKIAYRMA
RGADKSTSVRRIAIAHDGYEQTLPSNDRALLDTLLELRARSVRPASPPPDPPRTARLYKA
TQPHRVTPVTVPSLRPAARLEEVKRAPLFREDLTDDGVYIVDSGSRGVWAWIGPQATGPG
KRGALAAARGLARAKRHTGAVCVTTAGREPLEFASLFRNWRWCDARRDIRVRAARSATTK
LDAVNLATNAWLAAEAQLPDDGSGSLRVWRVRRCGVDEDAEKEADGALAEVERPQAAAFY
DRDCYIVLYTYHSPNGDQTMIYYWMGGSAPNDLRNLGAKEAKDLYIKLGRLPVQAWVYQG
KEPAHFLQIFKGRMITYVGSATDYDPSGRRVIPPSRVLILVSGQYAREAR
(135 a.a.)

- SilkBase 1999-2023 -