SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoIG40445_3prime_partial:A_BomoIG_DN15204_c0_g1_i1
Scaffold_idBomo_Chr16
NCBI non-redundant
(nr)
AMP-activated_protein_kinase_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0003682 F chromatin binding
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004679 F AMP-activated protein kinase activity
GO:0004712 F protein serine/threonine/tyrosine kinase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006468 P protein phosphorylation
GO:0006629 P lipid metabolic process
GO:0006631 P fatty acid metabolic process
GO:0006633 P fatty acid biosynthetic process
GO:0006694 P steroid biosynthetic process
GO:0006695 P cholesterol biosynthetic process
GO:0006853 P carnitine shuttle
GO:0006914 P autophagy
GO:0006950 P response to stress
GO:0007050 P regulation of cell cycle
GO:0007165 P signal transduction
GO:0008202 P steroid metabolic process
GO:0008203 P cholesterol metabolic process
GO:0008610 P lipid biosynthetic process
GO:0010468 P regulation of gene expression
GO:0010508 P positive regulation of autophagy
GO:0014850 P response to muscle activity
GO:0016055 P Wnt signaling pathway
GO:0016126 P sterol biosynthetic process
GO:0016236 P macroautophagy
GO:0016239 P positive regulation of macroautophagy
GO:0016241 P regulation of macroautophagy
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016568 P chromatin organization
GO:0016740 F transferase activity
GO:0031588 C nucleotide-activated protein kinase complex
GO:0031669 P cellular response to nutrient levels
GO:0032007 P negative regulation of TOR signaling
GO:0035174 F histone serine kinase activity
GO:0035404 P histone-serine phosphorylation
GO:0035556 P intracellular signal transduction
GO:0035690 P cellular response to xenobiotic stimulus
GO:0042149 P cellular response to glucose starvation
GO:0042304 P regulation of fatty acid biosynthetic process
GO:0042593 P glucose homeostasis
GO:0042752 P regulation of circadian rhythm
GO:0043066 P negative regulation of apoptotic process
GO:0045821 P positive regulation of glycolytic process
GO:0046872 F metal ion binding
GO:0047322 F [hydroxymethylglutaryl-CoA reductase (NADPH)] kinase activity
GO:0048511 P rhythmic process
GO:0050405 F [acetyl-CoA carboxylase] kinase activity
GO:0055089 P fatty acid homeostasis
GO:0071380 P cellular response to prostaglandin E stimulus
GO:1901796 P regulation of signal transduction by p53 class mediator
GO:2000505 P energy homeostasis
RNA-seq EntryA_BomoIG_DN15204_c0_g1_i1
Sequence
(Amino Acid)
MAEKPDKPVPASANCQPIVKIGHYTLGTTLGVGTFGKVKIGEHQLTKHKVAIKILNRQKI
KSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPTDIFMIMEYVSGGELFDYIVKRGKLQ
EHEARRFFQQIISGVDYCHRHMIVHRDLKPENLLLDHNMHVKIADFGLSNMMMDGEFLRT
SCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDEHVPTLFRKIKSGIFP
IPEYLNKSVVSLLCMMLQVDPMKRATIEDVKKHDWFLKDLPEYLFPSPVEQDSSVIDTEA
IAEVCDKFGVKEHEVHNALLSGDPHDQLAIAYHLIIDNKRIADEAAKAEIKDFYVASNSP
PAVTETNRPHPERIAPLRDSTAPPPQDKARGTPVKRAKWHLGIRSQSKPNDIMLEVFRAM
KALDYEWKVINPYHVRVRTLNKMTEKYVKMSLQLYQVDYKSYLLDFKSLSGEREESDEEG
GSVTPVPPPPPPPPSPH
(164 a.a.)

- SilkBase 1999-2023 -