SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoIG38499_complete:A_BomoIG_DN15705_c0_g1_i1
Scaffold_idBomo_Chr10
NCBI non-redundant
(nr)		integrin_beta-8_isoform_X2_[Bombyx_mori]
Ontology
GO:0001664 F G protein-coupled receptor binding
GO:0004872 F signaling receptor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005886 C plasma membrane
GO:0006914 P autophagy
GO:0007154 P cell communication
GO:0007155 P cell adhesion
GO:0007160 P cell-matrix adhesion
GO:0007229 P integrin-mediated signaling pathway
GO:0008305 C integrin complex
GO:0009611 P response to wounding
GO:0009986 C cell surface
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0030054 C cell junction
GO:0030056 C hemidesmosome
GO:0030198 P extracellular matrix organization
GO:0031252 C cell leading edge
GO:0031581 P hemidesmosome assembly
GO:0035878 P nail development
GO:0043235 C receptor complex
GO:0043588 P skin development
GO:0048333 P mesodermal cell differentiation
GO:0048565 P digestive tract development
GO:0048870 P cell motility
GO:0070062 C extracellular exosome
GO:0072001 P renal system development
GO:0097186 P amelogenesis
RNA-seq EntryA_BomoIG_DN15705_c0_g1_i1
Sequence
(Amino Acid)
MQCSRVKVAFLFLSVLPWTIMAAKRPFVMDERWVCAVKVSCFDCLKLSQCSWCVKENKCF
SNELWGNKGLCVNDTIEFTDFGLSIVENAQCSCQSKENEDNCFSPEVTKGLKCSGRGTCV
CGHCVCDTDAANPSKMIMGEYCEYDNFSCDGPKCTEGPYHISQVYENDGSFKVYRDDSLV
EKDYSS
*(61 a.a.)

- SilkBase 1999-2023 -