SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoIG16532_internal:A_BomoIG_DN32620_c2_g2_i10
Scaffold_idBomo_Chr9
NCBI non-redundant
(nr)		moesin/ezrin/radixin_homolog_1_isoform_X1_[Bombyx_mori]
Ontology
GO:0000132 P establishment of mitotic spindle orientation
GO:0000902 P cell morphogenesis
GO:0000912 P assembly of actomyosin apparatus involved in cytokinesis
GO:0002009 P morphogenesis of an epithelium
GO:0003779 F actin binding
GO:0005515 F protein binding
GO:0005546 F phosphatidylinositol-4,5-bisphosphate binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005819 C spindle
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0005884 C actin filament
GO:0005886 C plasma membrane
GO:0005912 C adherens junction
GO:0005938 C cell cortex
GO:0007010 P cytoskeleton organization
GO:0007052 P mitotic spindle organization
GO:0007091 P metaphase/anaphase transition of mitotic cell cycle
GO:0007314 P oocyte anterior/posterior axis specification
GO:0007315 P pole plasm assembly
GO:0007318 P pole plasm protein localization
GO:0007368 P determination of left/right symmetry
GO:0007399 P nervous system development
GO:0008017 F microtubule binding
GO:0008092 F cytoskeletal protein binding
GO:0008104 P protein localization
GO:0008284 P positive regulation of cell population proliferation
GO:0008360 P regulation of cell shape
GO:0009952 P anterior/posterior pattern specification
GO:0015629 C actin cytoskeleton
GO:0016020 C membrane
GO:0016057 P regulation of membrane potential in photoreceptor cell
GO:0016324 C apical plasma membrane
GO:0016336 P establishment or maintenance of polarity of larval imaginal disc epithelium
GO:0019898 C extrinsic component of membrane
GO:0030029 P actin filament-based process
GO:0030036 P actin cytoskeleton organization
GO:0030054 C cell junction
GO:0030866 P cortical actin cytoskeleton organization
GO:0032154 C cleavage furrow
GO:0032956 P regulation of actin cytoskeleton organization
GO:0034453 P microtubule anchoring
GO:0035003 C subapical complex
GO:0035088 P establishment or maintenance of apical/basal cell polarity
GO:0035149 P lumen formation, open tracheal system
GO:0042048 P olfactory behavior
GO:0042052 P rhabdomere development
GO:0042462 P eye photoreceptor cell development
GO:0043622 P cortical microtubule organization
GO:0045169 C fusome
GO:0045197 P establishment or maintenance of epithelial cell apical/basal polarity
GO:0045313 P rhabdomere membrane biogenesis
GO:0045433 P male courtship behavior, veined wing generated song production
GO:0045807 P positive regulation of endocytosis
GO:0051653 P spindle localization
GO:0072499 P photoreceptor cell axon guidance
GO:1902846 P positive regulation of mitotic spindle elongation
GO:1990023 C mitotic spindle midzone
RNA-seq EntryA_BomoIG_DN32620_c2_g2_i10
Sequence
(Amino Acid)
CVCVIITIKMVAGGKQMNVRVTTMDAELEFAIQQTTTGKQLFDQVVKTIGLREVWFFGLQ
YTDSKGDLTWIKLYKKSGSLPFSSWVMQQDVKKENPLQFKFRAKFYPEDVADELIQEITL
KLFYLQVKNAILSDEIYCPPETSVLLASYAVQARHGEHNPALHGPGFLANDRLLPQRVTD
QHKMSREEWEQSITNWWQEHREMLREDAMMEYLKIAQDLEMYGVNYFEIRNKKNTELWLG
VDALGLNIYEKDDKLTPKIGFPWSEIRNISFNEIGRAS
(91 a.a.)

- SilkBase 1999-2023 -