SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoIG1521_internal:A_BomoIG_DN30282_c0_g1_i7
Scaffold_idBomo_Chr26
NCBI non-redundant
(nr)		melanotransferrin_[Bombyx_mori]
Ontology
GO:0001558 P regulation of cell growth
GO:0005506 F iron ion binding
GO:0005515 F protein binding
GO:0005576 C extracellular region
GO:0005615 C extracellular space
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006810 P transport
GO:0006811 P ion transport
GO:0009986 C cell surface
GO:0010756 P positive regulation of plasminogen activation
GO:0016020 C membrane
GO:0031225 C anchored component of membrane
GO:0042127 P regulation of cell population proliferation
GO:0046658 C anchored component of plasma membrane
GO:0046872 F metal ion binding
GO:0055072 P iron ion homeostasis
GO:0070062 C extracellular exosome
GO:0090091 P positive regulation of extracellular matrix disassembly
GO:0097286 P iron ion transport
GO:1900025 P negative regulation of substrate adhesion-dependent cell spreading
RNA-seq EntryA_BomoIG_DN30282_c0_g1_i7
Sequence
(Amino Acid)
CHTGIGMAAGWLYPLAYLLSSGWIRPYGCNGAHAAAEYWTKSCAPGALSSEYVDSGSLPY
DNLCHLCHGASFRRCRRDASEQYFGHVGAVRCMVEGGGDVAFVRHTAPAEVSAGRRREFW
ARDLLPDDLQLLCPDGTADILLTIACEDP
(48 a.a.)

- SilkBase 1999-2023 -