SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoIG15103_5prime_partial:A_BomoIG_DN32656_c1_g1_i4
Scaffold_idBomo_Chr5
NCBI non-redundant
(nr)		bifunctional_arginine_demethylase_and_lysyl-hydroxylase_PSR_[Bombyx_mori]
Ontology
GO:0002040 P sprouting angiogenesis
GO:0003723 F RNA binding
GO:0003727 F single-stranded RNA binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005730 C nucleolus
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006397 P mRNA processing
GO:0007275 P multicellular organism development
GO:0008380 P RNA splicing
GO:0016491 F oxidoreductase activity
GO:0016568 P chromatin organization
GO:0018395 P peptidyl-lysine hydroxylation to 5-hydroxy-L-lysine
GO:0030154 P cell differentiation
GO:0033746 F histone H3-methyl-arginine-2 demethylase activity
GO:0033749 F histone H3-methyl-arginine-3 demethylase activity
GO:0046872 F metal ion binding
GO:0048024 P regulation of mRNA splicing, via spliceosome
GO:0051213 F dioxygenase activity
GO:0055114 P obsolete oxidation-reduction process
GO:0070078 P histone H3-R2 demethylation
GO:0070079 P histone H4-R3 demethylation
GO:0070815 F peptidyl-lysine 5-dioxygenase activity
RNA-seq EntryA_BomoIG_DN32656_c1_g1_i4
Sequence
(Amino Acid)
QTCALPISWFKLIYPKTQLDTWPKEYQPVEILQRPGDTVFVPGGWWHVVLNLDDTVAITQ
NFCSRTNFPVVWHKSVRGRPKLSKKWLKVLEAKEPDLYKIASSVDVNQSTGVASDSSSNS
SSSSSDSDTSSSDSSEEDSGQESITAHKKKRRKKL
*(51 a.a.)

- SilkBase 1999-2023 -