SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoIG14875_3prime_partial:A_BomoIG_DN32630_c3_g1_i7
Scaffold_idBomo_Chr23
NCBI non-redundant
(nr)		anoctamin-4_isoform_X2_[Bombyx_mori]
Ontology
GO:0005227 F calcium activated cation channel activity
GO:0005229 F intracellular calcium activated chloride channel activity
GO:0005247 F voltage-gated chloride channel activity
GO:0005254 F chloride channel activity
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005886 C plasma membrane
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006812 P cation transport
GO:0006821 P chloride transport
GO:0007200 P phospholipase C-activating G protein-coupled receptor signaling pathway
GO:0007275 P multicellular organism development
GO:0015111 F iodide transmembrane transporter activity
GO:0015705 P iodide transport
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016324 C apical plasma membrane
GO:0034220 P ion transmembrane transport
GO:0034605 P cellular response to heat
GO:0034707 C chloride channel complex
GO:0035774 P positive regulation of insulin secretion involved in cellular response to glucose stimulus
GO:0046983 F protein dimerization activity
GO:0050965 P detection of temperature stimulus involved in sensory perception of pain
GO:0070062 C extracellular exosome
GO:0098655 P cation transmembrane transport
GO:1902476 P chloride transmembrane transport
GO:1903959 P regulation of anion transmembrane transport
RNA-seq EntryA_BomoIG_DN32630_c3_g1_i7
Sequence
(Amino Acid)
MQILLRVRYDNTETKMGIRRLLNDGTYLGCFPLHEGRYDTDSADGTVTDRRLLYLEWARP
SKWFKKQPLWLVRRYFGDKIGLYFCWLGFYTKMLYAPAIVGTLCFLYGLASMESGDNIPS
QEICDLKGPGNTT
(43 a.a.)

- SilkBase 1999-2023 -