SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoIG14820_complete:A_BomoIG_DN32689_c0_g1_i24
Scaffold_idBomo_Chr21
NCBI non-redundant
(nr)		PREDICTED:_protein_unc-13_homolog_B-like_[Papilio_polytes]
Ontology
GO:0001566 F non-kinase phorbol ester receptor activity
GO:0005737 C cytoplasm
GO:0005794 C Golgi apparatus
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0006887 P exocytosis
GO:0007268 P chemical synaptic transmission
GO:0007528 P neuromuscular junction development
GO:0010808 P positive regulation of synaptic vesicle priming
GO:0016020 C membrane
GO:0016081 P synaptic vesicle docking
GO:0016082 P synaptic vesicle priming
GO:0019992 F diacylglycerol binding
GO:0030054 C cell junction
GO:0031594 C neuromuscular junction
GO:0035249 P synaptic transmission, glutamatergic
GO:0035556 P intracellular signal transduction
GO:0043195 C terminal bouton
GO:0045202 C synapse
GO:0046872 F metal ion binding
GO:0048172 P regulation of short-term neuronal synaptic plasticity
GO:0060384 P innervation
GO:0097151 P positive regulation of inhibitory postsynaptic potential
RNA-seq EntryA_BomoIG_DN32689_c0_g1_i24
Sequence
(Amino Acid)
MFRPFIEVNLIGPHLADKKRKFATKSKSNNWSPKFNETFHFMVSATEQLELFELHVCVRD
YCFAREDRLVGVAVMRLADIAEQGSCACWLPLGTRVKMDETGWTILRILSQRHSDEVARE
FVKLKSEMRAEAPAGGQGPS
*(46 a.a.)

- SilkBase 1999-2023 -