SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoIG14533_complete:A_BomoIG_DN32661_c2_g8_i3
Scaffold_idBomo_Chr4
NCBI non-redundant
(nr)		Serine/threonine-protein_kinase_24_[Operophtera_brumata]
Ontology
GO:0000166 F nucleotide binding
GO:0000278 P mitotic cell cycle
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004702 F obsolete signal transducer, downstream of receptor, with serine/threonine kinase activity
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0005886 C plasma membrane
GO:0006468 P protein phosphorylation
GO:0016020 C membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016324 C apical plasma membrane
GO:0016740 F transferase activity
GO:0023014 P signal transduction
GO:0030154 P cell differentiation
GO:0043066 P negative regulation of apoptotic process
GO:0043407 P negative regulation of MAP kinase activity
GO:0046872 F metal ion binding
GO:0048477 P oogenesis
GO:0051019 F mitogen-activated protein kinase binding
GO:0051321 P meiotic cell cycle
GO:0060281 P regulation of oocyte development
RNA-seq EntryA_BomoIG_DN32661_c2_g8_i3
Sequence
(Amino Acid)
MAFSEKVDPELIFTKQEKIGKGSFGEVFKGVDNRTQQVVAIKIIDLEEAEDEIEDIQQEI
MVLSQCDSPYVTKYYGSYLKVSEIFRLPYSFLLSVKQFDMMINRTHRSS
*(35 a.a.)

- SilkBase 1999-2023 -