SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoIG14529_complete:A_BomoIG_DN32661_c2_g1_i5
Scaffold_idBomo_Chr5
NCBI non-redundant
(nr)		E3_ubiquitin-protein_ligase_Topors_[Bombyx_mori]
Ontology
GO:0000151 C ubiquitin ligase complex
GO:0000209 P protein polyubiquitination
GO:0000922 C spindle pole
GO:0000930 C gamma-tubulin complex
GO:0003677 F DNA binding
GO:0003823 F antigen binding
GO:0004842 F ubiquitin-protein transferase activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005814 C centriole
GO:0005868 C cytoplasmic dynein complex
GO:0006351 P transcription, DNA-templated
GO:0006511 P ubiquitin-dependent protein catabolic process
GO:0006513 P protein monoubiquitination
GO:0006974 P cellular response to DNA damage stimulus
GO:0008270 F zinc ion binding
GO:0008630 P intrinsic apoptotic signaling pathway in response to DNA damage
GO:0010842 P retina layer formation
GO:0016605 C PML body
GO:0016607 C nuclear speck
GO:0016874 F ligase activity
GO:0016925 P protein sumoylation
GO:0019789 F SUMO transferase activity
GO:0030496 C midbody
GO:0032391 C photoreceptor connecting cilium
GO:0034504 P protein localization to nucleus
GO:0035845 P photoreceptor cell outer segment organization
GO:0036064 C ciliary basal body
GO:0042127 P regulation of cell population proliferation
GO:0042771 P intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
GO:0043066 P negative regulation of apoptotic process
GO:0043161 P proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0044547 F DNA topoisomerase binding
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0046548 P retinal rod cell development
GO:0046549 P retinal cone cell development
GO:0046872 F metal ion binding
GO:0051443 P positive regulation of ubiquitin-protein transferase activity
GO:0051457 P maintenance of protein location in nucleus
GO:0061630 F ubiquitin protein ligase activity
GO:0070936 P protein K48-linked ubiquitination
RNA-seq EntryA_BomoIG_DN32661_c2_g1_i5
Sequence
(Amino Acid)
MFEIYRLVPWLNRELNYLLNENVSHISYVLMRILERLLLYDITSSQFREAMRRFFGERTE
HFLHELHCFATSPYDMNGYDRNVQYTTESRALTMVNEVISTSESDGSIDTDVAMIPNSVA
AEPPAGPSGVRRAPPRAALAAHAVMPIETIANSDTDDSSEVMVVGYIKPPKDRTPELVDL
VGSDSDVVVEESSRAKSGPSDTRPTIPPVSKLKLKRSRAGGTELSDSDTDDSYQSPARRR
RRPRISNSGMMASTHRTTPEPTSTASEYDTADELTPPS
*(92 a.a.)

- SilkBase 1999-2023 -