SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoIG14343_internal:A_BomoIG_DN32633_c4_g2_i3
Scaffold_idBomo_Chr5
NCBI non-redundant
(nr)		SLIT_and_NTRK-like_protein_4_[Bombyx_mori]
Ontology
GO:0000139 C Golgi membrane
GO:0000166 F nucleotide binding
GO:0000186 P obsolete activation of MAPKK activity
GO:0001934 P positive regulation of protein phosphorylation
GO:0004672 F protein kinase activity
GO:0004675 F transmembrane receptor protein serine/threonine kinase activity
GO:0004713 F protein tyrosine kinase activity
GO:0004714 F transmembrane receptor protein tyrosine kinase activity
GO:0005004 F GPI-linked ephrin receptor activity
GO:0005030 F neurotrophin receptor activity
GO:0005166 F neurotrophin p75 receptor binding
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0005768 C endosome
GO:0005769 C early endosome
GO:0005770 C late endosome
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006468 P protein phosphorylation
GO:0007169 P transmembrane receptor protein tyrosine kinase signaling pathway
GO:0007178 P transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0007190 P activation of adenylate cyclase activity
GO:0007202 P activation of phospholipase C activity
GO:0007264 P small GTPase mediated signal transduction
GO:0007265 P Ras protein signal transduction
GO:0007275 P multicellular organism development
GO:0007399 P nervous system development
GO:0007411 P axon guidance
GO:0007568 P aging
GO:0007611 P learning or memory
GO:0007623 P circadian rhythm
GO:0008285 P negative regulation of cell population proliferation
GO:0009314 P response to radiation
GO:0009986 C cell surface
GO:0010465 F nerve growth factor receptor activity
GO:0010623 P programmed cell death involved in cell development
GO:0010976 P positive regulation of neuron projection development
GO:0014823 P response to activity
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0018108 P peptidyl-tyrosine phosphorylation
GO:0019233 P sensory perception of pain
GO:0019900 F kinase binding
GO:0021553 P olfactory nerve development
GO:0030154 P cell differentiation
GO:0030183 P B cell differentiation
GO:0030424 C axon
GO:0030425 C dendrite
GO:0031410 C cytoplasmic vesicle
GO:0031667 P response to nutrient levels
GO:0031901 C early endosome membrane
GO:0031902 C late endosome membrane
GO:0035094 P response to nicotine
GO:0038180 P nerve growth factor signaling pathway
GO:0042490 P mechanoreceptor differentiation
GO:0042493 P response to xenobiotic stimulus
GO:0042803 F protein homodimerization activity
GO:0043025 C neuronal cell body
GO:0043068 P positive regulation of programmed cell death
GO:0043234 C protein-containing complex
GO:0043235 C receptor complex
GO:0043524 P negative regulation of neuron apoptotic process
GO:0043547 P positive regulation of GTPase activity
GO:0045471 P response to ethanol
GO:0045766 P positive regulation of angiogenesis
GO:0046579 P positive regulation of Ras protein signal transduction
GO:0046777 P protein autophosphorylation
GO:0048011 P neurotrophin TRK receptor signaling pathway
GO:0048013 P ephrin receptor signaling pathway
GO:0048406 F nerve growth factor binding
GO:0048485 P sympathetic nervous system development
GO:0048678 P response to axon injury
GO:0050965 P detection of temperature stimulus involved in sensory perception of pain
GO:0050966 P detection of mechanical stimulus involved in sensory perception of pain
GO:0051092 P positive regulation of NF-kappaB transcription factor activity
GO:0051599 P response to hydrostatic pressure
GO:0051602 P response to electrical stimulus
GO:0051965 P positive regulation of synapse assembly
GO:0051968 P positive regulation of synaptic transmission, glutamatergic
GO:0060009 P Sertoli cell development
GO:0060384 P innervation
GO:0060385 P axonogenesis involved in innervation
GO:0061368 P behavioral response to formalin induced pain
GO:0070374 P positive regulation of ERK1 and ERK2 cascade
GO:0071316 P cellular response to nicotine
GO:0071363 P cellular response to growth factor stimulus
GO:1901215 P negative regulation of neuron death
GO:1990090 P cellular response to nerve growth factor stimulus
RNA-seq EntryA_BomoIG_DN32633_c4_g2_i3
Sequence
(Amino Acid)
VLFRSVKVREVPPRLFHGNPKLTNIYMKNNALETLEASHFPIDRLQELEISGNPFACNCS
LLWLWKLGKDSETTTKKSGNSSEFLKIDYEDVKCSGPLQLKGMLFVQIPESEFGCSSGRS
EERRV
(40 a.a.)

- SilkBase 1999-2023 -