SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoIG14229_complete:A_BomoIG_DN32623_c2_g1_i4
Scaffold_idBomo_Chr25
NCBI non-redundant
(nr)		sodium/calcium_exchanger_2_[Bombyx_mori]
Ontology
GO:0001666 P response to hypoxia
GO:0002026 P regulation of the force of heart contraction
GO:0002027 P regulation of heart rate
GO:0002028 P regulation of sodium ion transport
GO:0005432 F calcium:sodium antiporter activity
GO:0005509 F calcium ion binding
GO:0005515 F protein binding
GO:0005516 F calmodulin binding
GO:0005739 C mitochondrion
GO:0005829 C cytosol
GO:0005874 C microtubule
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006814 P sodium ion transport
GO:0006816 P calcium ion transport
GO:0006874 P cellular calcium ion homeostasis
GO:0006883 P cellular sodium ion homeostasis
GO:0006936 P muscle contraction
GO:0007154 P cell communication
GO:0007204 P positive regulation of cytosolic calcium ion concentration
GO:0007584 P response to nutrient
GO:0008092 F cytoskeletal protein binding
GO:0009749 P response to glucose
GO:0010649 P regulation of cell communication by electrical coupling
GO:0010763 P positive regulation of fibroblast migration
GO:0010881 P regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion
GO:0010882 P regulation of cardiac muscle contraction by calcium ion signaling
GO:0014704 C intercalated disc
GO:0014829 P vascular associated smooth muscle contraction
GO:0015297 F antiporter activity
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0021537 P telencephalon development
GO:0030018 C Z disc
GO:0030315 C T-tubule
GO:0030501 P positive regulation of bone mineralization
GO:0030506 F ankyrin binding
GO:0033198 P response to ATP
GO:0034614 P cellular response to reactive oxygen species
GO:0035725 P sodium ion transmembrane transport
GO:0035902 P response to immobilization stress
GO:0035994 P response to muscle stretch
GO:0042383 C sarcolemma
GO:0042493 P response to xenobiotic stimulus
GO:0042542 P response to hydrogen peroxide
GO:0042995 C cell projection
GO:0043197 C dendritic spine
GO:0043198 C dendritic shaft
GO:0044325 F transmembrane transporter binding
GO:0044557 P relaxation of smooth muscle
GO:0046872 F metal ion binding
GO:0051481 P negative regulation of cytosolic calcium ion concentration
GO:0051924 P regulation of calcium ion transport
GO:0055013 P cardiac muscle cell development
GO:0055074 P calcium ion homeostasis
GO:0055085 P transmembrane transport
GO:0055119 P relaxation of cardiac muscle
GO:0060048 P cardiac muscle contraction
GO:0060401 P cytosolic calcium ion transport
GO:0060402 P calcium ion transport into cytosol
GO:0070509 P calcium ion import
GO:0070588 P calcium ion transmembrane transport
GO:0071313 P cellular response to caffeine
GO:0071320 P cellular response to cAMP
GO:0071436 P sodium ion export across plasma membrane
GO:0071456 P cellular response to hypoxia
GO:0086012 P membrane depolarization during cardiac muscle cell action potential
GO:0086064 P cell communication by electrical coupling involved in cardiac conduction
GO:0097369 P sodium ion import across plasma membrane
GO:0098735 P positive regulation of the force of heart contraction
GO:1901660 P calcium ion export
GO:1903779 P regulation of cardiac conduction
RNA-seq EntryA_BomoIG_DN32623_c2_g1_i4
Sequence
(Amino Acid)
MMGLPKAGEITRAQLRIKESKEFKNTVDKLVQRANASIIIGTSSWKEQFAEALTANSGSD
DPDEPPSCFDYVLHVVTLFWKIIFALIPPTDIGGGYVCFVVSIICIGLVTAVIGDVASHF
GCTLGIKDSVTAIVFVALGTSIPDTFASKVAAIQDKHADASVGNVTGSNAVNVFLGIGVA
WTVAAIFHWSKNEKFHVDPGNLAFSVTMFCSEAALAVLVLVLRRRRSIGGELGGPRGIKI
VTSMFFFSLWLIYLIMSGLEAYDVIEGF
*(88 a.a.)

- SilkBase 1999-2023 -