SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoIG1414_5prime_partial:A_BomoIG_DN30205_c1_g1_i2
Scaffold_idBomo_Chr15
NCBI non-redundant
(nr)
neuroligin-4,_Y-linked_isoform_X1_[Bombyx_mori]
Ontology
GO:0002087 P regulation of respiratory gaseous exchange by nervous system process
GO:0004872 F signaling receptor activity
GO:0005515 F protein binding
GO:0005615 C extracellular space
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006898 P receptor-mediated endocytosis
GO:0007155 P cell adhesion
GO:0007158 P neuron cell-cell adhesion
GO:0007416 P synapse assembly
GO:0007612 P learning
GO:0008542 P visual learning
GO:0009986 C cell surface
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0030054 C cell junction
GO:0030139 C endocytic vesicle
GO:0030425 C dendrite
GO:0030534 P adult behavior
GO:0035176 P social behavior
GO:0042043 F neurexin family protein binding
GO:0043025 C neuronal cell body
GO:0045202 C synapse
GO:0048675 P axon extension
GO:0048709 P oligodendrocyte differentiation
GO:0050804 P modulation of chemical synaptic transmission
GO:0050808 P synapse organization
GO:0050839 F cell adhesion molecule binding
GO:0051965 P positive regulation of synapse assembly
GO:0051966 P regulation of synaptic transmission, glutamatergic
GO:0051968 P positive regulation of synaptic transmission, glutamatergic
GO:0052689 F carboxylic ester hydrolase activity
GO:0060024 P rhythmic synaptic transmission
GO:0060076 C excitatory synapse
GO:0060077 C inhibitory synapse
GO:0060079 P excitatory postsynaptic potential
GO:0060080 P inhibitory postsynaptic potential
GO:0060291 P long-term synaptic potentiation
GO:0060999 P positive regulation of dendritic spine development
GO:0061001 P regulation of dendritic spine morphogenesis
GO:0061002 P negative regulation of dendritic spine morphogenesis
GO:0071625 P vocalization behavior
GO:0090394 P negative regulation of excitatory postsynaptic potential
GO:0097104 P postsynaptic membrane assembly
GO:0097105 P presynaptic membrane assembly
GO:0097110 F scaffold protein binding
GO:0097151 P positive regulation of inhibitory postsynaptic potential
GO:0098794 C postsynapse
GO:1900271 P regulation of long-term synaptic potentiation
GO:1902474 P positive regulation of protein localization to synapse
GO:2000310 P regulation of NMDA receptor activity
GO:2000311 P regulation of AMPA receptor activity
GO:2000331 P regulation of terminal button organization
GO:2000463 P positive regulation of excitatory postsynaptic potential
GO:2000809 P positive regulation of synaptic vesicle clustering
GO:2000969 P positive regulation of AMPA receptor activity
RNA-seq EntryA_BomoIG_DN30205_c1_g1_i2
Sequence
(Amino Acid)
DPVYYSLKLAKHMNCTVPEDLSKDHEVIVDCLREASIRDLLAADISPPNYLTAFGPSVDG
VVIKTDFGKDFLTMYSTGDFPSFGPLNNMNFNFNVHKKRSDSGRRLFQNKYDLLFGVVTS
EALWKFSAGDVQNGIEPDKRDRMLRTYVRNSYTYHLSEIFYTIVNEYTDWERTVESPTNT
RDATVAALSDAQYVAPIVQSGDLLSGGPKPAPNDDEGPGRPTKTYFYVFDYQTKDGYYPQ
RLGAVHGEELPYVFGAPAVDGFGHFPQNYTKSELALSESIMMFLANFAKTGDPNDNTRQE
ALLPASRERNKFRGVNWEEYDSTHQKYLEIGMKPRLKNHYRAHQLSVWLRLVPELHRAGM
EDVAARHNLFKNHNEQDLYEGIVRPDPLARNNDNEPIRRGNGSYAETALSTVDSILATCA
TILPGRDLQTTNTTDNTLGHLEAAGYAAYSTALSVTIAIGCSLLILNVLIFAGVYYQRDK
SRSRGKQHRFNEKHFETISGKHSHYHIDPTHAPSLVVDVERQSRKKHMMGTEQHLSNLNF
KGPLDVPKSPPSPSLSLDNMMLSSKLGSRANSFRIPNSGYPQVGSYATMPKNSGQFNNSP
PLQELRQKYQPPNGSTGQGSPRREERAAHATLRRGAPSNLPQAAIDEMRV
*(216 a.a.)

- SilkBase 1999-2023 -