SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoIG14146_complete:A_BomoIG_DN32655_c4_g3_i6
Scaffold_idBomo_Chr4
NCBI non-redundant
(nr)		whirlin_[Bombyx_mori]
Ontology
GO:0001895 P retina homeostasis
GO:0001917 C photoreceptor inner segment
GO:0002141 C stereocilia ankle link
GO:0002142 C stereocilia ankle link complex
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005884 C actin filament
GO:0005929 C cilium
GO:0007605 P sensory perception of sound
GO:0010628 P positive regulation of gene expression
GO:0021694 P cerebellar Purkinje cell layer formation
GO:0030426 C growth cone
GO:0032391 C photoreceptor connecting cilium
GO:0032420 C stereocilium
GO:0032421 C stereocilium bundle
GO:0032426 C stereocilium tip
GO:0036064 C ciliary basal body
GO:0042803 F protein homodimerization activity
GO:0042995 C cell projection
GO:0045184 P establishment of protein localization
GO:0046982 F protein heterodimerization activity
GO:0050953 P sensory perception of light stimulus
GO:0060122 P inner ear receptor cell stereocilium organization
GO:1990075 C periciliary membrane compartment
GO:1990227 P paranodal junction maintenance
GO:1990696 C USH2 complex
RNA-seq EntryA_BomoIG_DN32655_c4_g3_i6
Sequence
(Amino Acid)
MSRSFDMKEEGNALIDDRGGIRRHQSMQRLQHGDQQTDESRAARVVSDHHGNLHITVKKT
KPILGIAIEGGANTKHPLPRIINIHEHGAAYEAGGLEVGQLILAVDGHRVEGMQHQDVAR
LIAESFAQRDKPEIEFLVVEAKKSNLEPKPTALIFLEA
*(52 a.a.)

- SilkBase 1999-2023 -