SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoIG1384_complete:A_BomoIG_DN30297_c5_g1_i1
Scaffold_idBomo_Chr2
NCBI non-redundant
(nr)		cysteine_dioxygenase_type_1_[Bombyx_mori]
Ontology
GO:0000097 P sulfur amino acid biosynthetic process
GO:0005506 F iron ion binding
GO:0005829 C cytosol
GO:0006534 P cysteine metabolic process
GO:0007595 P lactation
GO:0008198 F ferrous iron binding
GO:0010243 P response to organonitrogen compound
GO:0016491 F oxidoreductase activity
GO:0017172 F cysteine dioxygenase activity
GO:0019448 P L-cysteine catabolic process
GO:0019451 P L-cysteine catabolic process to pyruvate, using cysteine dioxygenase
GO:0033762 P response to glucagon
GO:0042412 P taurine biosynthetic process
GO:0043200 P response to amino acid
GO:0045471 P response to ethanol
GO:0046439 P L-cysteine metabolic process
GO:0046872 F metal ion binding
GO:0051213 F dioxygenase activity
GO:0051384 P response to glucocorticoid
GO:0051591 P response to cAMP
GO:0055114 P obsolete oxidation-reduction process
RNA-seq EntryA_BomoIG_DN30297_c5_g1_i1
Sequence
(Amino Acid)
MILCWGPGHASAIHDHADSHCFMKLLSGSLEEIRYDWPDDVQPEVLRTIKENANTGDQNC
DNQTVMSTDYNDSCQRHNDSCQGDSHMNSGEEDEDYYDLKEIGRTRLEVNDVCYINGKSI
ICNCRIC
*(41 a.a.)

- SilkBase 1999-2023 -