SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoIG1363_internal:A_BomoIG_DN30253_c4_g3_i3
Scaffold_idBomo_Chr21
NCBI non-redundant
(nr)
ubiquilin-1_isoform_X1_[Bombyx_mori]
Ontology
GO:0000502 C proteasome complex
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005776 C autophagosome
GO:0005783 C endoplasmic reticulum
GO:0005886 C plasma membrane
GO:0006914 P autophagy
GO:0016020 C membrane
GO:0016235 C aggresome
GO:0016241 P regulation of macroautophagy
GO:0019904 F protein domain specific binding
GO:0030433 P ubiquitin-dependent ERAD pathway
GO:0031396 P regulation of protein ubiquitination
GO:0031398 P positive regulation of protein ubiquitination
GO:0031410 C cytoplasmic vesicle
GO:0031593 F polyubiquitin modification-dependent protein binding
GO:0035973 P aggrephagy
GO:0048471 C perinuclear region of cytoplasm
GO:0071456 P cellular response to hypoxia
GO:1901340 P negative regulation of store-operated calcium channel activity
GO:1902175 P regulation of oxidative stress-induced intrinsic apoptotic signaling pathway
GO:1903071 P positive regulation of ER-associated ubiquitin-dependent protein catabolic process
GO:2000785 P regulation of autophagosome assembly
RNA-seq EntryA_BomoIG_DN30253_c4_g3_i3
Sequence
(Amino Acid)
ALPIWHIQEPMLNVASSMAGNPFSGLVDNSADGTNPQQGSENRQPLPNPWQRGGGGGGGG
ASQGSASAAGSGSGPGLINTPGMQSLLQQMSENPRRSEE
(32 a.a.)

- SilkBase 1999-2023 -