SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoIG13342_complete:A_BomoIG_DN31307_c1_g1_i4
Scaffold_idBomo_Chr5
NCBI non-redundant
(nr)		cullin-4A_[Bombyx_mori]
Ontology
GO:0000082 P G1/S transition of mitotic cell cycle
GO:0000715 P nucleotide-excision repair, DNA damage recognition
GO:0000717 P nucleotide-excision repair, DNA duplex unwinding
GO:0001701 P in utero embryonic development
GO:0005515 F protein binding
GO:0005654 C nucleoplasm
GO:0006281 P DNA repair
GO:0006283 P transcription-coupled nucleotide-excision repair
GO:0006293 P nucleotide-excision repair, preincision complex stabilization
GO:0006294 P nucleotide-excision repair, preincision complex assembly
GO:0006295 P nucleotide-excision repair, DNA incision, 3'-to lesion
GO:0006296 P nucleotide-excision repair, DNA incision, 5'-to lesion
GO:0006511 P ubiquitin-dependent protein catabolic process
GO:0006974 P cellular response to DNA damage stimulus
GO:0007050 P regulation of cell cycle
GO:0008284 P positive regulation of cell population proliferation
GO:0008285 P negative regulation of cell population proliferation
GO:0016032 P viral process
GO:0016567 P protein ubiquitination
GO:0030097 P hemopoiesis
GO:0030853 P negative regulation of granulocyte differentiation
GO:0031461 C cullin-RING ubiquitin ligase complex
GO:0031464 C Cul4A-RING E3 ubiquitin ligase complex
GO:0031625 F ubiquitin protein ligase binding
GO:0033683 P nucleotide-excision repair, DNA incision
GO:0035019 P somatic stem cell population maintenance
GO:0042769 P obsolete DNA damage response, detection of DNA damage
GO:0042787 P ubiquitin-dependent protein catabolic process
GO:0043161 P proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0051246 P regulation of protein metabolic process
GO:0061630 F ubiquitin protein ligase activity
GO:0070911 P global genome nucleotide-excision repair
GO:0080008 C Cul4-RING E3 ubiquitin ligase complex
GO:0097193 P intrinsic apoptotic signaling pathway
GO:1900087 P positive regulation of G1/S transition of mitotic cell cycle
GO:2000001 P regulation of DNA damage checkpoint
GO:2000819 P regulation of nucleotide-excision repair
RNA-seq EntryA_BomoIG_DN31307_c1_g1_i4
Sequence
(Amino Acid)
MSGLAETPISAKEGGNLYKKRSLPVSESCSKRVKINEMSAEEKISNFSLVNPNSNGIKMS
STSMNKPGVTAKKLIIKNFKSKPNLPDNYQETTWSKLREAVVAIQTSKSIAYSLEELYQA
VENMCSHKMASQLYVNLTNLVEAHVKANIEQFLSESMDRQVFLKRMDDCWRAHCRQMIMI
RSIFLYLDRTYVLQNPSIHSIWDMGLDLFRHHIAMNTLVQTRTVDGLLLLIERERGGDSV
DISLLKSLLRMLSDLQIYQEAFEHKYVK
*(88 a.a.)

- SilkBase 1999-2023 -