SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoIG12866_complete:A_BomoIG_DN31365_c2_g1_i12
Scaffold_idBomo_Chr18
NCBI non-redundant
(nr)		hormone-sensitive_lipase_[Bombyx_mori]
Ontology
GO:0005515 F protein binding
GO:0005615 C extracellular space
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005811 C lipid droplet
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0005901 C caveola
GO:0006361 P transcription initiation from RNA polymerase I promoter
GO:0006363 P termination of RNA polymerase I transcription
GO:0006629 P lipid metabolic process
GO:0007565 P female pregnancy
GO:0008152 P metabolic process
GO:0008202 P steroid metabolic process
GO:0008203 P cholesterol metabolic process
GO:0016020 C membrane
GO:0016042 P lipid catabolic process
GO:0016298 F lipase activity
GO:0016787 F hydrolase activity
GO:0016788 F hydrolase activity, acting on ester bonds
GO:0019433 P triglyceride catabolic process
GO:0033878 F hormone-sensitive lipase activity
GO:0042134 F rRNA primary transcript binding
GO:0042493 P response to xenobiotic stimulus
GO:0047372 F acylglycerol lipase activity
RNA-seq EntryA_BomoIG_DN31365_c2_g1_i12
Sequence
(Amino Acid)
MGAMQTRLAYITGSSAIVRPTQEDLAVRTNLDALIARSPSEEFIFSVPRDPYLSPYWADD
ELLKMFPPVRILTVHLDPCLDDCVMFAKKLKTLGNVVGIEVLEGLPHGFLNFSLMVKEAN
EGSKLCVERMKQLFDLDAAPAAADNQL
*(48 a.a.)

- SilkBase 1999-2023 -