SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoIG12507_3prime_partial:A_BomoIG_DN31326_c2_g2_i1
Scaffold_idBomo_Chr15
NCBI non-redundant
(nr)
exocyst_complex_component_2_[Bombyx_mori]
Ontology
GO:0000145 C exocyst
GO:0000281 P mitotic cytokinesis
GO:0005642 C annulate lamellae
GO:0005737 C cytoplasm
GO:0005886 C plasma membrane
GO:0005938 C cell cortex
GO:0006810 P transport
GO:0006887 P exocytosis
GO:0006893 P Golgi to plasma membrane transport
GO:0007269 P neurotransmitter secretion
GO:0007298 P border follicle cell migration
GO:0007349 P cellularization
GO:0010629 P negative regulation of gene expression
GO:0015031 P protein transport
GO:0016028 C rhabdomere
GO:0016080 P synaptic vesicle targeting
GO:0016081 P synaptic vesicle docking
GO:0016192 P vesicle-mediated transport
GO:0017137 F small GTPase binding
GO:0030136 C clathrin-coated vesicle
GO:0032456 P endocytic recycling
GO:0035003 C subapical complex
GO:0035147 P branch fusion, open tracheal system
GO:0043001 P Golgi to plasma membrane protein transport
GO:0045056 P transcytosis
GO:0045087 P innate immune response
GO:0048215 P positive regulation of Golgi vesicle fusion to target membrane
GO:0048599 P oocyte development
GO:0055037 C recycling endosome
GO:0071896 P protein localization to adherens junction
GO:0072659 P protein localization to plasma membrane
GO:0072697 P protein localization to cell cortex
GO:0098793 C presynapse
RNA-seq EntryA_BomoIG_DN31326_c2_g2_i1
Sequence
(Amino Acid)
MDQLDRLVLLKNMYEEDQRKNGKEPLQSLETAIEDSIKLADSLFSEILSRKENADKTREA
LSLLTRHKFLFQLPSSIDQNIRKKEYDLVVNDYNRVKNLFGNTDVKLFQKILSEIDKKIE
DLKEKLFVRMKTMPINVQEQMKYIRLLISLKWEEDAAWVAITARKEYLMSLLNKVKDHFK
QKEEQDNNEKGKRHKSREEGEAARRSA
(68 a.a.)

- SilkBase 1999-2023 -