SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoIG1240_complete:A_BomoIG_DN30239_c4_g3_i1
Scaffold_idBomo_Chr24
NCBI non-redundant
(nr)
uncharacterized_protein_LOC101746134_[Bombyx_mori]
Ontology
GO:0001736 P establishment of planar polarity
GO:0001764 P neuron migration
GO:0001843 P neural tube closure
GO:0001942 P hair follicle development
GO:0004871 F obsolete signal transducer activity
GO:0004888 F transmembrane signaling receptor activity
GO:0004930 F G protein-coupled receptor activity
GO:0005509 F calcium ion binding
GO:0005654 C nucleoplasm
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0007155 P cell adhesion
GO:0007156 P homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007165 P signal transduction
GO:0007166 P cell surface receptor signaling pathway
GO:0007186 P G protein-coupled receptor signaling pathway
GO:0007266 P Rho protein signal transduction
GO:0007275 P multicellular organism development
GO:0007417 P central nervous system development
GO:0007626 P locomotory behavior
GO:0009952 P anterior/posterior pattern specification
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0032956 P regulation of actin cytoskeleton organization
GO:0042060 P wound healing
GO:0042249 P establishment of planar polarity of embryonic epithelium
GO:0042472 P inner ear morphogenesis
GO:0045176 P apical protein localization
GO:0046983 F protein dimerization activity
GO:0048105 P establishment of body hair planar orientation
GO:0060071 P Wnt signaling pathway, planar cell polarity pathway
GO:0060488 P orthogonal dichotomous subdivision of terminal units involved in lung branching morphogenesis
GO:0060489 P planar dichotomous subdivision of terminal units involved in lung branching morphogenesis
GO:0060490 P lateral sprouting involved in lung morphogenesis
GO:0090179 P planar cell polarity pathway involved in neural tube closure
GO:0090251 P protein localization involved in establishment of planar polarity
RNA-seq EntryA_BomoIG_DN30239_c4_g3_i1
Sequence
(Amino Acid)
MWQMWSNYAAEFRMKSKLYPININLCCCLGVCTLIYIQAVLGVSSPSQCERIALLLHYTH
ITCAMWIVALAAAVAEYCTCDTLLPLKYNYLLAYGVPAVVVMFNYALSMEHYEIKHYCWM
SIEKGMVMGFMVPAMILILINTGIVILGLKSVNKKQAEMLTAKIQELVDHHITNWPKNDQ
NGDKNASIETLDNIYTPSSSRKNTDSSETLDKDYNASEEDYNYSNNGVANDEAGENPIER
SASNKTIQDKSLLNMLYMDNISLKWSWNTEGNELKTYLNLCLILEPFFAINWVMGVVAIE
NATHWSTPTIYLILIVSMYMYLTGTICTTLPIVQQKTPVPPCCEDVVIEPFLTRTRTTDS
IPLLDPTVQQPNVTPAPADTISTISI
*(128 a.a.)

- SilkBase 1999-2023 -