| Name | O_BomoIG11969_5prime_partial:A_BomoIG_DN31323_c3_g5_i2 |
| Scaffold_id | Bomo_Chr16 |
NCBI non-redundant (nr) | citron_Rho-interacting_kinase_[Bombyx_mori] |
| Ontology |
| GO:0000166 |
F |
nucleotide binding |
| GO:0000910 |
P |
cytokinesis |
| GO:0004672 |
F |
protein kinase activity |
| GO:0004674 |
F |
protein serine/threonine kinase activity |
| GO:0005515 |
F |
protein binding |
| GO:0005524 |
F |
ATP binding |
| GO:0005737 |
C |
cytoplasm |
| GO:0005829 |
C |
cytosol |
| GO:0006468 |
P |
protein phosphorylation |
| GO:0007049 |
P |
cell cycle |
| GO:0007067 |
P |
mitotic cell cycle |
| GO:0007275 |
P |
multicellular organism development |
| GO:0007399 |
P |
nervous system development |
| GO:0016020 |
C |
membrane |
| GO:0016301 |
F |
kinase activity |
| GO:0016310 |
P |
phosphorylation |
| GO:0016740 |
F |
transferase activity |
| GO:0017124 |
F |
SH3 domain binding |
| GO:0030154 |
P |
cell differentiation |
| GO:0030165 |
F |
PDZ domain binding |
| GO:0032467 |
P |
positive regulation of cytokinesis |
| GO:0035556 |
P |
intracellular signal transduction |
| GO:0046872 |
F |
metal ion binding |
| GO:0048699 |
P |
generation of neurons |
| GO:0051301 |
P |
cell division |
| GO:0097110 |
F |
scaffold protein binding |
|
| RNA-seq Entry | A_BomoIG_DN31323_c3_g5_i2 |
Sequence (Amino Acid) | QSGDVYALKTLRKEQSRKRAIACTEDERDVLASTTSPWIPRLQYAFQDSNNLYLVMELCS
GGDLAGLMSRRNHPLSERDAAFYIAEVAHALKALHGMGYIHRDVKPHNIFIDRCGHVKLG
DFGSCLRLSGGGGASAAVVAGTADYVAPELLAAADCAARHTVCLQYCRGIHDQPIVGLHD
NRFCLRDL
*(62 a.a.) |