SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoIG11967_3prime_partial:A_BomoIG_DN31323_c3_g2_i2
Scaffold_idBomo_Chr16
NCBI non-redundant
(nr)
citron_Rho-interacting_kinase_[Bombyx_mori]
Ontology
GO:0000070 P mitotic sister chromatid segregation
GO:0000166 F nucleotide binding
GO:0000910 P cytokinesis
GO:0001726 C ruffle
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0005773 C vacuole
GO:0005829 C cytosol
GO:0006468 P protein phosphorylation
GO:0007049 P cell cycle
GO:0007067 P mitotic cell cycle
GO:0007091 P metaphase/anaphase transition of mitotic cell cycle
GO:0007275 P multicellular organism development
GO:0007283 P spermatogenesis
GO:0007399 P nervous system development
GO:0015629 C actin cytoskeleton
GO:0016020 C membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016358 P dendrite development
GO:0016740 F transferase activity
GO:0017124 F SH3 domain binding
GO:0030154 P cell differentiation
GO:0030165 F PDZ domain binding
GO:0032467 P positive regulation of cytokinesis
GO:0035556 P intracellular signal transduction
GO:0045665 P negative regulation of neuron differentiation
GO:0046872 F metal ion binding
GO:0048699 P generation of neurons
GO:0050774 P negative regulation of dendrite morphogenesis
GO:0051301 P cell division
GO:0097110 F scaffold protein binding
RNA-seq EntryA_BomoIG_DN31323_c3_g2_i2
Sequence
(Amino Acid)
MEPSKEAIAVRIARLNRQILGKATSGVSRSKKTVDREALLDALTVLYDECNDDPIKKTDE
LVRAFVDKYRSTLAELRRTRVCISDFEVVQTIGRGYFGEVNMVREKQSGDV
(36 a.a.)

- SilkBase 1999-2023 -