SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoIG11625_complete:A_BomoIG_DN31361_c6_g1_i11
Scaffold_idBomo_Chr28
NCBI non-redundant
(nr)
structural_maintenance_of_chromosomes_protein_5_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0000722 P telomere maintenance via recombination
GO:0000724 P double-strand break repair via homologous recombination
GO:0000781 C chromosome, telomeric region
GO:0000803 C sex chromosome
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005694 C chromosome
GO:0006281 P DNA repair
GO:0006303 P double-strand break repair via nonhomologous end joining
GO:0006310 P DNA recombination
GO:0006974 P cellular response to DNA damage stimulus
GO:0007049 P cell cycle
GO:0007067 P mitotic cell cycle
GO:0016605 C PML body
GO:0016925 P protein sumoylation
GO:0030054 C cell junction
GO:0030915 C Smc5-Smc6 complex
GO:0034184 P positive regulation of maintenance of mitotic sister chromatid cohesion
GO:0035061 C interchromatin granule
GO:0035861 C site of double-strand break
GO:0045842 P positive regulation of mitotic metaphase/anaphase transition
GO:0051301 P cell division
GO:0051984 P positive regulation of chromosome segregation
GO:0090398 P cellular senescence
RNA-seq EntryA_BomoIG_DN31361_c6_g1_i11
Sequence
(Amino Acid)
MFALLNCAGEVRLDKGNSDEDYDKYGVVVLVRFRESEELQPLCRKRHSGGERALSIALYL
MALQRLFTVPFRCVDEINQGMDEINERKMFQLLVQVTSECENSQYFLLTPKVSSVTTGY
*(39 a.a.)

- SilkBase 1999-2023 -