SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoIG11566_5prime_partial:A_BomoIG_DN31301_c4_g3_i1
Scaffold_idBomo_Chr23
NCBI non-redundant
(nr)		nonclathrin_coat_protein_gamma2-COP,_partial_[Bombyx_mori]
Ontology
GO:0000139 C Golgi membrane
GO:0000281 P mitotic cytokinesis
GO:0005198 F structural molecule activity
GO:0005737 C cytoplasm
GO:0005783 C endoplasmic reticulum
GO:0005794 C Golgi apparatus
GO:0005801 C cis-Golgi network
GO:0006810 P transport
GO:0006886 P intracellular protein transport
GO:0006890 P retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum
GO:0006909 P phagocytosis
GO:0007112 P male meiosis cytokinesis
GO:0007424 P open tracheal system development
GO:0007436 P larval salivary gland morphogenesis
GO:0008362 P chitin-based embryonic cuticle biosynthetic process
GO:0009306 P protein secretion
GO:0010883 P regulation of lipid storage
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016192 P vesicle-mediated transport
GO:0030117 C membrane coat
GO:0030126 C COPI vesicle coat
GO:0030198 P extracellular matrix organization
GO:0030663 C COPI-coated vesicle membrane
GO:0031410 C cytoplasmic vesicle
GO:0035147 P branch fusion, open tracheal system
GO:0035149 P lumen formation, open tracheal system
GO:0035158 P regulation of tube diameter, open tracheal system
GO:0048812 P neuron projection morphogenesis
RNA-seq EntryA_BomoIG_DN31301_c4_g3_i1
Sequence
(Amino Acid)
DLETKKPLVEIEVRKPVQMSIEEIYAEQLAKIPGIEKLGPLFKTNLPIDLTEAEIEYRVR
VVKHVYARHVIFQFECVNTLNDQILEDVHVRLEVPPEYEIKSIVPCQKLVYNTQDNVFVV
VEYPCAFIDSLGSFMATLEFVVRDCDPNTGTPDPGEGYADSYPLEEFEMGCSDQIRARAG
GDDWEQTWERAANVPEANDTFVLSQTDVGDAAKAVCEHLGLPNGSISGDAVKEIRGGGIF
RGGAPVLVRARLAGSSAGVTMKLSARSPREDVAQLLLAAVG
*(93 a.a.)

- SilkBase 1999-2023 -