SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoIG1122_complete:A_BomoIG_DN30255_c2_g3_i6
Scaffold_idBomo_Chr24
NCBI non-redundant
(nr)		zinc_finger_protein_90-like_isoform_X3_[Helicoverpa_armigera]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0001162 F RNA polymerase II intronic transcription regulatory region sequence-specific DNA binding
GO:0001227 F DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0005515 F protein binding
GO:0005622 C intracellular anatomical structure
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0016363 C nuclear matrix
GO:0017053 C transcription repressor complex
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046872 F metal ion binding
RNA-seq EntryA_BomoIG_DN30255_c2_g3_i6
Sequence
(Amino Acid)
MKATYKAHMRFHTNYCVCESCGKRCRNNNQLQEHKRARHGLGRIHKCAYCEYSSATKEAL
TIHERRHTGERPYVCDHCGATFHRRSNLVQHIAIHLPEKNFQVPTTNLMLLKSS
*(37 a.a.)

- SilkBase 1999-2023 -