SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoIG11222_5prime_partial:A_BomoIG_DN31355_c2_g1_i8
Scaffold_idBomo_Chr7
NCBI non-redundant
(nr)
organic_cation_transporter_protein_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0005215 F transporter activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006814 P sodium ion transport
GO:0006855 P xenobiotic transmembrane transport
GO:0009437 P carnitine metabolic process
GO:0015226 F carnitine transmembrane transporter activity
GO:0015238 F xenobiotic transmembrane transporter activity
GO:0015293 F symporter activity
GO:0015491 F cation:cation antiporter activity
GO:0015651 F quaternary ammonium group transmembrane transporter activity
GO:0015697 P quaternary ammonium group transport
GO:0015879 P carnitine transport
GO:0015893 P xenobiotic transport
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016324 C apical plasma membrane
GO:0022857 F transmembrane transporter activity
GO:0030165 F PDZ domain binding
GO:0031526 C brush border membrane
GO:0052106 P obsolete quorum sensing involved in interaction with host
GO:0055085 P transmembrane transport
GO:0060731 P positive regulation of intestinal epithelial structure maintenance
GO:0070062 C extracellular exosome
GO:0070715 P sodium-dependent organic cation transport
GO:0098655 P cation transmembrane transport
GO:1902603 P carnitine transmembrane transport
RNA-seq EntryA_BomoIG_DN31355_c2_g1_i8
Sequence
(Amino Acid)
SLHPFLPYVIPPSAAILSFINAYNLVIICPYLFPQIPGLPLSAYFSKRFGRRVAIIGMFV
INCICNLLLVLPDAWFYLKLVAGSIANACGAAAFSVVYVYTTELFPTVARNMAMGASSTT
TRAGSMLAPFFGELNVLASWLPPIVFGLFPVLGIVACYFLPETKGKQLDDHLDES
*(57 a.a.)

- SilkBase 1999-2023 -