SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoIG10995_complete:A_BomoIG_DN31347_c4_g2_i4
Scaffold_idBomo_Chr3
NCBI non-redundant
(nr)
long-chain-fatty-acid--CoA_ligase_5_isoform_X2_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0001676 P long-chain fatty acid metabolic process
GO:0003824 F catalytic activity
GO:0003987 F acetate-CoA ligase activity
GO:0004467 F long-chain fatty acid-CoA ligase activity
GO:0005524 F ATP binding
GO:0005739 C mitochondrion
GO:0005741 C mitochondrial outer membrane
GO:0005777 C peroxisome
GO:0005778 C peroxisomal membrane
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0005886 C plasma membrane
GO:0006629 P lipid metabolic process
GO:0006631 P fatty acid metabolic process
GO:0006641 P triglyceride metabolic process
GO:0007584 P response to nutrient
GO:0008152 P metabolic process
GO:0008610 P lipid biosynthetic process
GO:0010033 P response to organic substance
GO:0014070 P response to organic cyclic compound
GO:0015908 P fatty acid transport
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016874 F ligase activity
GO:0031090 C organelle membrane
GO:0033211 P adiponectin-activated signaling pathway
GO:0034201 P response to oleic acid
GO:0042178 P xenobiotic catabolic process
GO:0042493 P response to xenobiotic stimulus
GO:0043231 C intracellular membrane-bounded organelle
GO:0044539 P long-chain fatty acid import into cell
GO:0071902 P positive regulation of protein serine/threonine kinase activity
RNA-seq EntryA_BomoIG_DN31347_c4_g2_i4
Sequence
(Amino Acid)
MEYYAAQGQGEVCVQGANVFKGYFKDAEKTREVIDQDGWHHTGDVGKWLPNGTLKIIDRR
KHIFKLSQGEYIVPEKIENIYIRSQYVEQVFVHGESLKSCVVAIVVPDVDVVKCWALEYG
IKGTFSSLCEDERVKKVIMEDMLQWGRNAGLKTFEQVKDIYLHPDPFSVQNGLLTPTMKA
KRPEIRSYFKPQIEDMYKQLE
*(66 a.a.)

- SilkBase 1999-2023 -