SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoIG10647_3prime_partial:A_BomoIG_DN33739_c7_g1_i22
Scaffold_idBomo_Chr17
NCBI non-redundant
(nr)
LOW_QUALITY_PROTEIN:_voltage-dependent_T-type_calcium_channel_subunit_alpha-1G_[Bombyx_mori]
Ontology
GO:0005216 F ion channel activity
GO:0005244 F voltage-gated ion channel activity
GO:0005245 F voltage-gated calcium channel activity
GO:0005262 F calcium channel activity
GO:0005886 C plasma membrane
GO:0005891 C voltage-gated calcium channel complex
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006816 P calcium ion transport
GO:0007204 P positive regulation of cytosolic calcium ion concentration
GO:0008332 F low voltage-gated calcium channel activity
GO:0014824 P artery smooth muscle contraction
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0030425 C dendrite
GO:0034765 P regulation of ion transmembrane transport
GO:0043025 C neuronal cell body
GO:0044297 C cell body
GO:0045956 P positive regulation of calcium ion-dependent exocytosis
GO:0048471 C perinuclear region of cytoplasm
GO:0051924 P regulation of calcium ion transport
GO:0055085 P transmembrane transport
GO:0060402 P calcium ion transport into cytosol
GO:0070509 P calcium ion import
GO:0070588 P calcium ion transmembrane transport
GO:0071549 P cellular response to dexamethasone stimulus
GO:0086010 P membrane depolarization during action potential
GO:0086015 P SA node cell action potential
GO:0086016 P AV node cell action potential
GO:0086018 P SA node cell to atrial cardiac muscle cell signaling
GO:0086027 P AV node cell to bundle of His cell signaling
GO:0086045 P membrane depolarization during AV node cell action potential
GO:0086046 P membrane depolarization during SA node cell action potential
GO:0086056 F voltage-gated calcium channel activity involved in AV node cell action potential
GO:0086059 F voltage-gated calcium channel activity involved SA node cell action potential
GO:0086091 P regulation of heart rate by cardiac conduction
RNA-seq EntryA_BomoIG_DN33739_c7_g1_i22
Sequence
(Amino Acid)
MEPTGCLKEKEHYSLYIFAPENKMRRFCVWIVTRSWFDNIVLLFIALNCITLAMERPNIP
PDSKERQFLSSANYVFTAVFAIEMFIKVVASGMFYGHEAYFTSGWNIMDGSLVIISIIDL
LMSLVSESSPRIFGILRVFRLLRSLRPLRVINRAPGLKLVVQTLLSSLRPIGNIVLICCT
FFIIFGILGVQLFKGAFFYCEGANIKNVKNKTD
(70 a.a.)

- SilkBase 1999-2023 -