SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoIG10644_complete:A_BomoIG_DN33739_c7_g1_i21
Scaffold_idBomo_Chr17
NCBI non-redundant
(nr)
LOW_QUALITY_PROTEIN:_voltage-dependent_T-type_calcium_channel_subunit_alpha-1G_[Bombyx_mori]
Ontology
GO:0005216 F ion channel activity
GO:0005244 F voltage-gated ion channel activity
GO:0005245 F voltage-gated calcium channel activity
GO:0005262 F calcium channel activity
GO:0005891 C voltage-gated calcium channel complex
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006816 P calcium ion transport
GO:0006936 P muscle contraction
GO:0007517 P muscle organ development
GO:0007520 P myoblast fusion
GO:0008016 P regulation of heart contraction
GO:0008332 F low voltage-gated calcium channel activity
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0032342 P aldosterone biosynthetic process
GO:0032870 P cellular response to hormone stimulus
GO:0034651 P cortisol biosynthetic process
GO:0034765 P regulation of ion transmembrane transport
GO:0035865 P cellular response to potassium ion
GO:0042391 P regulation of membrane potential
GO:0046872 F metal ion binding
GO:0055085 P transmembrane transport
GO:0070509 P calcium ion import
GO:0070588 P calcium ion transmembrane transport
GO:0086010 P membrane depolarization during action potential
GO:0097110 F scaffold protein binding
GO:2000344 P positive regulation of acrosome reaction
RNA-seq EntryA_BomoIG_DN33739_c7_g1_i21
Sequence
(Amino Acid)
MNLFGCKFCEKDQHGEQVCDRKNFDTLLWAFVTVFQVLTQEDWNVVLFNGMEKTSHWAAL
YFVALMTFGNYVLFNLLVAILVEGFSSERNERREREQRELAKSKLSSECFSENNELQYDE
SNSASHSSDSFSQVHTNYYFQVLYISLLTAIYTIILIIRTAKSEHQKYIMSLEYVVKH
*(58 a.a.)

- SilkBase 1999-2023 -