SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoIG10567_3prime_partial:A_BomoIG_DN33714_c0_g3_i1
Scaffold_idBomo_Chr24
NCBI non-redundant
(nr)
ADP/ATP_translocase_[Bombyx_mori]
Ontology
GO:0001508 P action potential
GO:0003735 F structural constituent of ribosome
GO:0005215 F transporter activity
GO:0005471 F ATP:ADP antiporter activity
GO:0005739 C mitochondrion
GO:0005743 C mitochondrial inner membrane
GO:0005811 C lipid droplet
GO:0005829 C cytosol
GO:0006412 P translation
GO:0006810 P transport
GO:0006839 P mitochondrial transport
GO:0007268 P chemical synaptic transmission
GO:0007629 P flight behavior
GO:0008340 P determination of adult lifespan
GO:0009612 P response to mechanical stimulus
GO:0010507 P negative regulation of autophagy
GO:0015866 P ADP transport
GO:0015867 P ATP transport
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0022857 F transmembrane transporter activity
GO:0031966 C mitochondrial membrane
GO:0034599 P cellular response to oxidative stress
GO:0040011 P locomotion
GO:0046716 P muscle cell cellular homeostasis
GO:0048477 P oogenesis
GO:0048489 P synaptic vesicle transport
GO:0051124 P synaptic assembly at neuromuscular junction
GO:0051480 P regulation of cytosolic calcium ion concentration
GO:0051560 P mitochondrial calcium ion homeostasis
GO:0051900 P regulation of mitochondrial depolarization
GO:0055085 P transmembrane transport
GO:0070050 P neuron cellular homeostasis
GO:2001171 P positive regulation of ATP biosynthetic process
RNA-seq EntryA_BomoIG_DN33714_c0_g3_i1
Sequence
(Amino Acid)
MSNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAF
VRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFAGNLA
SGGAAGATSLCFVYPLDFARTRLAADVGKGDGQREFSGLGNCISKIFKSDGLIGLYRGFG
VSVQ
(60 a.a.)

- SilkBase 1999-2023 -