SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoIG104180_internal:A_BomoIG_DN34453_c0_g1_i1
Scaffold_idBomo_Chr17
NCBI non-redundant
(nr)		LOW_QUALITY_PROTEIN:_protein_abnormal_spindle_[Bombyx_mori]
Ontology
GO:0000922 C spindle pole
GO:0001764 P neuron migration
GO:0002052 P positive regulation of neuroblast proliferation
GO:0005516 F calmodulin binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005819 C spindle
GO:0005856 C cytoskeleton
GO:0005874 C microtubule
GO:0007049 P cell cycle
GO:0007051 P spindle organization
GO:0007067 P mitotic cell cycle
GO:0007283 P spermatogenesis
GO:0007420 P brain development
GO:0008584 P male gonad development
GO:0021873 P forebrain neuroblast division
GO:0021987 P cerebral cortex development
GO:0030496 C midbody
GO:0036449 C microtubule minus-end
GO:0045665 P negative regulation of neuron differentiation
GO:0045769 P negative regulation of asymmetric cell division
GO:0048477 P oogenesis
GO:0048589 P developmental growth
GO:0051301 P cell division
GO:0051445 P regulation of meiotic cell cycle
GO:0051653 P spindle localization
GO:0051661 P maintenance of centrosome location
GO:0072687 C meiotic spindle
GO:0090263 P positive regulation of canonical Wnt signaling pathway
GO:0090306 P meiotic spindle assembly
GO:0097150 P neuronal stem cell population maintenance
GO:0097431 C mitotic spindle pole
RNA-seq EntryA_BomoIG_DN34453_c0_g1_i1
Sequence
(Amino Acid)
QRRIRANKIAIIAKRNEAANKIRNWYISILERNKCRSVFLKLKESAVVIQSFFRMYITRK
KYVEIKESIIIIQRFYRSYKLSIMERQRYDKIRHAIIKTQSCVRRYIQRRRYLELRSAAV
TIQSAYRLKRHRELVYEQRNTAAICIQKHMRRYIAQSFYTRLRNSAILIQKIWRGKLLTR
LMRCNYLQKRTLIIKFQAVIRGYLVRKQVRLQKENIIRMREIERRDWAASRIQALFRGHR
VRLAVANDRRVTDLRRRWREGALVSYQETLKERNEEAMDVLRNMC
(94 a.a.)

- SilkBase 1999-2023 -