SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoIG104168_internal:A_BomoIG_DN40766_c0_g1_i1
Scaffold_idBomo_Chr27
NCBI non-redundant
(nr)		glycine_receptor_subunit_alpha-2_[Bombyx_mori]
Ontology
GO:0005230 F extracellular ligand-gated ion channel activity
GO:0005254 F chloride channel activity
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006821 P chloride transport
GO:0007218 P neuropeptide signaling pathway
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016594 F glycine binding
GO:0016934 F extracellularly glycine-gated chloride channel activity
GO:0016935 C glycine-gated chloride channel complex
GO:0022824 F transmitter-gated ion channel activity
GO:0022852 F glycine-gated chloride ion channel activity
GO:0030054 C cell junction
GO:0030425 C dendrite
GO:0034707 C chloride channel complex
GO:0042995 C cell projection
GO:0043204 C perikaryon
GO:0045202 C synapse
GO:0045211 C postsynaptic membrane
GO:0046872 F metal ion binding
GO:0060012 P synaptic transmission, glycinergic
GO:0071230 P cellular response to amino acid stimulus
GO:0071294 P cellular response to zinc ion
GO:0071361 P cellular response to ethanol
GO:0099565 P chemical synaptic transmission, postsynaptic
GO:1902476 P chloride transmembrane transport
RNA-seq EntryA_BomoIG_DN40766_c0_g1_i1
Sequence
(Amino Acid)
VKLTLWLSCAMNFLIYPHDTQECKLQMESLSHTTDDLVFQWDPEVPLVVDENIELPQLEL
VQNRTADCTQVYSTGNFTCLEVIFKLKRRLGYHLFNTYIPTCLIVIMSWVSFWIKPDAAP
ARVTLGVTSLLTLSTQHAKSQAQLPPVSYLKAVDAFMSVCTVFVFMALMEYCLVNIVLGD
GAGKPKEAAEAAKARMRAINIDRFPRAFFPL
(69 a.a.)

- SilkBase 1999-2023 -