SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoIG104151_3prime_partial:A_BomoIG_DN47098_c0_g1_i1
Scaffold_idBomo_Chr27
NCBI non-redundant
(nr)		PREDICTED:_plexin_A3_[Plutella_xylostella]
Ontology
GO:0001843 P neural tube closure
GO:0001932 P regulation of protein phosphorylation
GO:0002116 C semaphorin receptor complex
GO:0005515 F protein binding
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0007162 P negative regulation of cell adhesion
GO:0007165 P signal transduction
GO:0007275 P multicellular organism development
GO:0007405 P neuroblast proliferation
GO:0007420 P brain development
GO:0008360 P regulation of cell shape
GO:0009986 C cell surface
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0017154 F semaphorin receptor activity
GO:0043087 P regulation of GTPase activity
GO:0050772 P positive regulation of axonogenesis
GO:0070062 C extracellular exosome
GO:0071526 P semaphorin-plexin signaling pathway
GO:1902287 P semaphorin-plexin signaling pathway involved in axon guidance
GO:2001222 P regulation of neuron migration
RNA-seq EntryA_BomoIG_DN47098_c0_g1_i1
Sequence
(Amino Acid)
MFVVLFMSLILLCTACFEDKNAEFQHLVVDRNSGHVFIGAVNKIYELSEDLAIEKWIPTG
PLNKTDDKLTDNVNKVLILDDSGRLITCGSALGICSIRNITNIYIGCDVPITVVSDEEKV
STVAFLAA
(41 a.a.)

- SilkBase 1999-2023 -