SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoIG10402_3prime_partial:A_BomoIG_DN33701_c3_g6_i4
Scaffold_idBomo_Chr18
NCBI non-redundant
(nr)
activating_transcription_factor_3_isoform_X2_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000976 F transcription cis-regulatory region binding
GO:0000977 F RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000982 F DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001078 F DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005634 C nucleus
GO:0005730 C nucleolus
GO:0006094 P gluconeogenesis
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0010628 P positive regulation of gene expression
GO:0030968 P endoplasmic reticulum unfolded protein response
GO:0034198 P cellular response to amino acid starvation
GO:0035914 P skeletal muscle cell differentiation
GO:0042802 F identical protein binding
GO:0042803 F protein homodimerization activity
GO:0043565 F sequence-specific DNA binding
GO:0044212 F transcription cis-regulatory region binding
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046982 F protein heterodimerization activity
GO:0070373 P negative regulation of ERK1 and ERK2 cascade
GO:1903984 P positive regulation of TRAIL-activated apoptotic signaling pathway
GO:1990440 P positive regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress
GO:1990622 C CHOP-ATF3 complex
RNA-seq EntryA_BomoIG_DN33701_c3_g6_i4
Sequence
(Amino Acid)
MNATSMSSTIPTIKCEDTSPSPVALGSDGESGTYNLSVNVNLSAAMINMLTAEGTNTTLR
TPEIVNDVITMTNPLDQYNYEKNSSFKNGSGNDSNSSMSNGSSATSPSSSTPPSIQKTCS
ELIKAGLKLSIESKRKMSGSDTDVSVKRLKKEESDEDYDSSHTQQAKNEGLTPEDEERRR
RRRERNKIAATKCRMKKRERTVNLVTESEVLENQNIDLKAQLKDLEVQKRQLIDMLSLHA
ASCVKNNSTTRQSPTMQYNMIRSYDSPSTF
(89 a.a.)

- SilkBase 1999-2023 -