SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoIG103832_internal:A_BomoIG_DN29840_c0_g1_i2
Scaffold_idBomo_Chr13
NCBI non-redundant
(nr)		cyclic_AMP_response_element-binding_protein_A_isoform_X2_[Bombyx_mori]
Ontology
GO:0001158 F cis-regulatory region sequence-specific DNA binding
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005634 C nucleus
GO:0005700 C polytene chromosome
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006366 P transcription by RNA polymerase II
GO:0007431 P salivary gland development
GO:0007435 P salivary gland morphogenesis
GO:0008363 P larval chitin-based cuticle development
GO:0009953 P dorsal/ventral pattern formation
GO:0010906 P regulation of glucose metabolic process
GO:0035293 P chitin-based larval cuticle pattern formation
GO:0042803 F protein homodimerization activity
GO:0043565 F sequence-specific DNA binding
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
RNA-seq EntryA_BomoIG_DN29840_c0_g1_i2
Sequence
(Amino Acid)
DVCSSDLLNSNKLSIKVTSSSGASGFNLPPTPPSSLSSSDSEGALSPAHEAAPPPAPPAP
SRRPHLYVSHHTRQPINTPLISSQPKGSTGTLVLTDEEKRTLLAEGYPVPTRLPLTKAEE
KSLKKIRRKIKNKISAQESRQIGRASC
(48 a.a.)

- SilkBase 1999-2023 -