SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoIG103673_3prime_partial:A_BomoIG_DN29862_c7_g3_i11
Scaffold_idBomo_Chr23
NCBI non-redundant
(nr)
copper-transporting_ATPase_2_isoform_X3_[Bombyx_mori]
Ontology
GO:0000139 C Golgi membrane
GO:0000166 F nucleotide binding
GO:0004008 F P-type divalent copper transporter activity
GO:0005375 F copper ion transmembrane transporter activity
GO:0005507 F copper ion binding
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005770 C late endosome
GO:0005794 C Golgi apparatus
GO:0005802 C trans-Golgi network
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0005923 C bicellular tight junction
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006812 P cation transport
GO:0006825 P copper ion transport
GO:0006878 P cellular copper ion homeostasis
GO:0006882 P cellular zinc ion homeostasis
GO:0007595 P lactation
GO:0007623 P circadian rhythm
GO:0008152 P metabolic process
GO:0008270 F zinc ion binding
GO:0010043 P response to zinc ion
GO:0015677 P copper ion import
GO:0015680 P protein maturation by copper ion transfer
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016023 C cytoplasmic vesicle
GO:0016323 C basolateral plasma membrane
GO:0016787 F hydrolase activity
GO:0019829 F ATPase-coupled cation transmembrane transporter activity
GO:0030001 P metal ion transport
GO:0032588 C trans-Golgi network membrane
GO:0034220 P ion transmembrane transport
GO:0035434 P copper ion transmembrane transport
GO:0043682 F P-type divalent copper transporter activity
GO:0046688 P response to copper ion
GO:0046872 F metal ion binding
GO:0048471 C perinuclear region of cytoplasm
GO:0051208 P sequestering of calcium ion
GO:0051591 P response to cAMP
GO:0060003 P copper ion export
RNA-seq EntryA_BomoIG_DN29862_c7_g3_i11
Sequence
(Amino Acid)
MRESDKMMSRSIKYQRLDDVEETGDNDQDLVAVRVPINGMTCQSCVRSIEGSVRDVPGVE
RVKVELSENAGYIRYDPRLCSLEAIRSHIENMGFEVPVDNDDESRNLLPKDVPTAIMIDM
TGSQTPPVSEVFLSVIGMTCQSCVNTIEGALKAKSGVTKGHVSLADGTARVAFLPSTVTP
REIADLIYELGFDVNIISVDGQVYTENKSQICNNTEGSGDCAKQLSPFKNKLQTNGSGPP
VAEAELSRCTLEVRGMTCASCVSAIEKHCTKLYGVRSVLIALLAAKAEVCYEPRKISALD
VANSITELGFPSEVISENDGSGLKEIHLLIKGMTCASCVNKIEKTVLKLTGVESCSVALT
TCKGRVKYNAEQIGPRTICHAVAGLGVEATVASRSEERRVGKECR
(134 a.a.)

- SilkBase 1999-2023 -