SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoIG103516_complete:A_BomoIG_DN29869_c4_g3_i1
Scaffold_idBomo_Chr11
NCBI non-redundant
(nr)
breast_cancer_anti-estrogen_resistance_protein_1_[Bombyx_mori]
Ontology
GO:0001558 P regulation of cell growth
GO:0001726 C ruffle
GO:0004871 F obsolete signal transducer activity
GO:0005515 F protein binding
GO:0005730 C nucleolus
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0005925 C focal adhesion
GO:0007015 P actin filament organization
GO:0007155 P cell adhesion
GO:0007173 P epidermal growth factor receptor signaling pathway
GO:0007186 P G protein-coupled receptor signaling pathway
GO:0007229 P integrin-mediated signaling pathway
GO:0008283 P cell population proliferation
GO:0008286 P insulin receptor signaling pathway
GO:0010595 P positive regulation of endothelial cell migration
GO:0015629 C actin cytoskeleton
GO:0016477 P cell migration
GO:0017124 F SH3 domain binding
GO:0019901 F protein kinase binding
GO:0030027 C lamellipodium
GO:0030054 C cell junction
GO:0030335 P positive regulation of cell migration
GO:0035729 P cellular response to hepatocyte growth factor stimulus
GO:0042981 P regulation of apoptotic process
GO:0048008 P platelet-derived growth factor receptor signaling pathway
GO:0048010 P vascular endothelial growth factor receptor signaling pathway
GO:0048011 P neurotrophin TRK receptor signaling pathway
GO:0048012 P hepatocyte growth factor receptor signaling pathway
GO:0050851 P antigen receptor-mediated signaling pathway
GO:0050852 P T cell receptor signaling pathway
GO:0050853 P B cell receptor signaling pathway
GO:0051301 P cell division
GO:0060326 P cell chemotaxis
RNA-seq EntryA_BomoIG_DN29869_c4_g3_i1
Sequence
(Amino Acid)
MSIPLGRETVLPTQCMARALYDNIAESPDELAFRRGDLLTVLEQNTGGSEGWWLCSLRGR
QGICPGNRLRIVAGVFDSSGATQRRRTRPPAPVAHQPLPTQQSPAFTKIEECSHYDVPRA
PMPVQRIATYDCPRPLGDWYDAPRAPRPASADSACSGTGSLASATSSASANSANSGSSAH
SASSTYDVPRTRALPLPCDAALEALERLQVQKFSILVLF
*(72 a.a.)

- SilkBase 1999-2023 -